[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56790.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  49/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:238 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  40->204 1fyeA_ c.23.16.4 * 1e-15 21.4 %
:RPS:PFM   81->171 PF03575 * Peptidase_S51 1e-12 40.7 %
:HMM:PFM   58->174 PF03575 * Peptidase_S51 3.7e-27 28.7 115/153  
:BLT:SWISS 40->236 YGAJ_BACSU 6e-34 39.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56790.1 GT:GENE BAD56790.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2121995..2122711 GB:FROM 2121995 GB:TO 2122711 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56790.1 LENGTH 238 SQ:AASEQ MPAERPTILATSMGFHRARDPWQPSPVFRLAFDLAGGPSRPRLCFVTTGTGDRQTSIDAFYAAFDGTGVMTSHLALFDKPNMPNVTEHLHEQDVIWVDRGSVVNLLAVWRAHGIDEILRDCWTRGVVMGGESAGSLCWFTGGTTDSFGSMRAFADGLSLLPFSNAVHYSDRREHFRSCVAAGELPEGYTTEAGAGLHFAGTECVGAFADRKSAAAYRVVRRSDGTVTEDQLEVRRLER GT:EXON 1|1-238:0| BL:SWS:NREP 1 BL:SWS:REP 40->236|YGAJ_BACSU|6e-34|39.7|194/230| RP:PFM:NREP 1 RP:PFM:REP 81->171|PF03575|1e-12|40.7|91/150|Peptidase_S51| HM:PFM:NREP 1 HM:PFM:REP 58->174|PF03575|3.7e-27|28.7|115/153|Peptidase_S51| GO:PFM:NREP 2 GO:PFM GO:0006508|"GO:proteolysis"|PF03575|IPR005320| GO:PFM GO:0008236|"GO:serine-type peptidase activity"|PF03575|IPR005320| HM:SCP:REP 40->204|1fyeA_|1e-15|21.4|159/0|c.23.16.4|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 49 OP:NHOMOORG 49 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1----1111111----1-1--1--11-11---1-----------------------------------------------------------------------------1------------------------1--1111-11-1----------1-----1-1--1-11111---1--11--11------------------------------------------------------------------------------------------------------1-------------------------1--------------111-1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccEEEEEEcccccccccccccHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHccEEEEccccHHHHHHHHHHccHHHHHHHHHHcccEEEEEccccEEEEEcccccccccccccccccccccccEEcccccHHHHHHHHHHcccccEEEEccccEEEEEEccEEEEEEccccccEEEEEEEEccccEEEEEEcEEEEcc //