[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56793.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.213.1
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   15->143 3e4xA PDBj 6e-07 15.6 %
:RPS:SCOP  7->139 2nsfA1  a.213.1.4 * 4e-06 11.8 %
:HMM:SCOP  5->139 1rxqA_ a.213.1.1 * 1.5e-14 27.9 %
:RPS:PFM   28->62 PF11716 * MDMPI_N 1e-04 54.3 %
:HMM:PFM   18->133 PF11716 * MDMPI_N 3.2e-16 32.1 112/140  
:HMM:PFM   130->162 PF00107 * ADH_zinc_N 0.0002 33.3 33/130  
:BLT:SWISS 26->138 Y037_MYCBO 1e-04 32.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56793.1 GT:GENE BAD56793.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2125109..2125708 GB:FROM 2125109 GB:TO 2125708 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56793.1 LENGTH 199 SQ:AASEQ MASDLVELDRRAVLTTMATAELVTPDDLSRPTPCAGWTVGDLLAHMAAQHRGFAASARGDGADLAHWHVRPPGPRTPAEYAESADDVLTAFAVPDVLERTFALPEFGPEVTVRGEQAVGFHLVDYVVHGWDLARALGVDYALDPDAADPVLRIAEMVPDGPDRDAPNSPFARALPVDDGSAALDRILRLLGRSPTWPDR GT:EXON 1|1-199:0| BL:SWS:NREP 1 BL:SWS:REP 26->138|Y037_MYCBO|1e-04|32.4|108/257| RP:PDB:NREP 1 RP:PDB:REP 15->143|3e4xA|6e-07|15.6|122/149| RP:PFM:NREP 1 RP:PFM:REP 28->62|PF11716|1e-04|54.3|35/127|MDMPI_N| HM:PFM:NREP 2 HM:PFM:REP 18->133|PF11716|3.2e-16|32.1|112/140|MDMPI_N| HM:PFM:REP 130->162|PF00107|0.0002|33.3|33/130|ADH_zinc_N| RP:SCP:NREP 1 RP:SCP:REP 7->139|2nsfA1|4e-06|11.8|127/160|a.213.1.4| HM:SCP:REP 5->139|1rxqA_|1.5e-14|27.9|129/174|a.213.1.1|1/1|DinB/YfiT-like putative metalloenzymes| OP:NHOMO 32 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- ----3---------1--11-1-----11111-1111112211---1--------------1---1-31-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 195 STR:RPRED 98.0 SQ:SECSTR ##cHHHHHHHHHHHHHHHHHHTccGGGTTcccccTTccHHHHHHHHHHHHHHHHHHHHTcGGGGGGGcccccccccHHHHHHHHHHHHHHHHcTTGGGcEEEEHcHHHcEEEHHEHHHHHHHHHHHHHHHHHHHHTcccccccccccEEHHHHHHHHHHTTTccccEEEEcccccccccEEccHHHHHHHccccccc## DISOP:02AL 1-3, 194-199| PSIPRED ccccHHHHHHHHHHHHHHHHHHccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHccccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHccccccccc //