[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56794.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   54->96 PF01965 * DJ-1_PfpI 0.00017 27.9 43/148  
:HMM:PFM   2->22 PF07045 * DUF1330 0.00052 52.4 21/65  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56794.1 GT:GENE BAD56794.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2125818..2126177 GB:FROM 2125818 GB:TO 2126177 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56794.1 LENGTH 119 SQ:AASEQ MAGARVLVIGVDPARLEGWDPEPVLAAIARGRDRFHAYGIDADWCLVALDEHPEDTITAALTRTDYACVVIGGGIRGHEPLLLFFENVINLVRRHAPQAAIAFNTTPEDCADAARRWVG GT:EXON 1|1-119:0| HM:PFM:NREP 2 HM:PFM:REP 54->96|PF01965|0.00017|27.9|43/148|DJ-1_PfpI| HM:PFM:REP 2->22|PF07045|0.00052|52.4|21/65|DUF1330| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1---------------------------1---1-------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHcccccEEEEEccccccccccEEHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHcc //