[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56795.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:67 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->36 PF10038 * DUF2274 8.9e-05 37.9 29/69  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56795.1 GT:GENE BAD56795.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2126294..2126497 GB:FROM 2126294 GB:TO 2126497 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56795.1 LENGTH 67 SQ:AASEQ MAARSHSQKLTIELDAERARALNALSELYHATPERMVASWAEYHIDRLRAGQTPDSHPSGWRPDTGA GT:EXON 1|1-67:0| HM:PFM:NREP 1 HM:PFM:REP 8->36|PF10038|8.9e-05|37.9|29/69|DUF2274| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12, 55-67| PSIPRED ccccccccEEEEEEcHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccccccccccccc //