[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56796.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   13->123 3d5pA PDBj 1e-07 17.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56796.1 GT:GENE BAD56796.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2126499..2126903 GB:FROM 2126499 GB:TO 2126903 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56796.1 LENGTH 134 SQ:AASEQ MTEPHIPGSPGRLRPTPPLDAVVRVDQSLPHGLGNQLRALYARCGGFLTPSGIAVYAVADTAERNATFEMARHAPGFALFGDDTGGRGFLVDARSLDARVYAGDLGDLDPADVGAVADDLSAWSARDACAGEDP GT:EXON 1|1-134:0| RP:PDB:NREP 1 RP:PDB:REP 13->123|3d5pA|1e-07|17.6|108/131| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1-1-----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 80.6 SQ:SECSTR ############EcccccHHHHHHHHHHHTccccHHHHHHHHHcccEEETEEEEEccHHHHHHHHHHHTHHHHccTTEEEEEETTEEEEEETTTccEEEEE###TTcccGGGcEEEEccHHHH########### DISOP:02AL 1-8, 131-134| PSIPRED ccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHccEEcccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccEEEEEEccccccEEEEEEcccccHHHHEEEcHHHHHHHHccccccccc //