[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56797.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:231 amino acids
:PSIPRED
:DISOPRED
:PROS 87->102|PS00024|HEMOPEXIN
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56797.1 GT:GENE BAD56797.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2126900..2127595 GB:FROM 2126900 GB:TO 2127595 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56797.1 LENGTH 231 SQ:AASEQ MSEAHPAVEVVTYDGLPAASGGAHRLRTRNPRLAWEAVQSFLDACVLAAGDPTVTLVVWKGGPPGPSEQLRAFATAALGGPRLQNRARSEWRVRPGAVDTVLAALRNADRDAVTQHGHPLASLVWDAQVRLLDPRTGEPHQDVSPETFARFPVDGYGRILGASGVRASIGTTASSISLWLSLPADDRLAAAARHLQHHLPVRLSPKHWRRWRPTRDGSSYRSTKIPSPLPE GT:EXON 1|1-231:0| PROS 87->102|PS00024|HEMOPEXIN|PDOC00023| SEG 180->200|lslpaddrlaaaarhlqhhlp| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------1----------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 227-231| PSIPRED ccccccEEEEEEEccccccccccHHHccccccHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHcccHHHHHHHcHHccccccHHHHHHHHHHcccHHHHHHcccHHHHHHHHcEEEEEccccccccccccHHHHHcccccccHHEEccccccHHccccccEEEEEEEccccHHHHHHHHHHHHccccEEcHHHHHHccccccccccccccccccccc //