[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56805.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.306.1
:79 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->46 2a6qB PDBj 6e-05 43.5 %
:RPS:PDB   1->47 2a6qB PDBj 1e-07 42.6 %
:RPS:SCOP  1->47 2a6qB1  d.306.1.1 * 7e-07 42.6 %
:HMM:SCOP  1->48 2a6qA1 d.306.1.1 * 9.1e-10 41.7 %
:HMM:PFM   1->64 PF02604 * PhdYeFM 1.3e-15 29.7 64/75  
:BLT:SWISS 1->46 YEFM_SHIFL 2e-04 43.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56805.1 GT:GENE BAD56805.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2133943..2134182 GB:FROM 2133943 GB:TO 2134182 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56805.1 LENGTH 79 SQ:AASEQ MTTMSAREFNRDVSAAKRAAAEGPVVITDRGAEAFVLLSIEEYRRLRADSQDIVQRLSMDDDIEFDPEPLAVRWQDPEL GT:EXON 1|1-79:0| BL:SWS:NREP 1 BL:SWS:REP 1->46|YEFM_SHIFL|2e-04|43.5|46/90| BL:PDB:NREP 1 BL:PDB:REP 1->46|2a6qB|6e-05|43.5|46/58| RP:PDB:NREP 1 RP:PDB:REP 1->47|2a6qB|1e-07|42.6|47/58| HM:PFM:NREP 1 HM:PFM:REP 1->64|PF02604|1.3e-15|29.7|64/75|PhdYeFM| RP:SCP:NREP 1 RP:SCP:REP 1->47|2a6qB1|7e-07|42.6|47/55|d.306.1.1| HM:SCP:REP 1->48|2a6qA1|9.1e-10|41.7|48/0|d.306.1.1|1/1|YefM-like| OP:NHOMO 35 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- -1---------1------------------------1-----1-------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1----------------1-------1--------112---2----------------------------2--1------------------------------------------1111-1----------------1--1-----------1----1----------------1--------------------------------------------------------------11-------------------------------------------------------------------------------------1------------------------------------------1--------------------------------------------------------111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 48 STR:RPRED 60.8 SQ:SECSTR ccEEEHHHHHHHHHHHHHHHHHHcEEEEccccccEEEccHHHHHHHHH############################### DISOP:02AL 1-2, 73-79| PSIPRED ccccccHHHHHHHHHHHHHHHcccEEEEccccEEEEEEcHHHHHHHcccHHHHHHHHcccccccccccccccccccccc //