[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56806.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  82/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:139 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->137 2h1cA PDBj 7e-06 27.6 %
:RPS:PDB   3->137 2bsqB PDBj 3e-15 29.0 %
:RPS:SCOP  3->137 2bsqA1  c.120.1.1 * 1e-16 28.2 %
:HMM:SCOP  1->139 2h1cA1 c.120.1.1 * 9.6e-27 34.6 %
:RPS:PFM   4->135 PF01850 * PIN 6e-06 36.6 %
:HMM:PFM   4->129 PF01850 * PIN 4e-17 27.6 116/126  
:BLT:SWISS 4->137 Y4JK_RHISN 3e-08 33.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56806.1 GT:GENE BAD56806.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2134179..2134598 GB:FROM 2134179 GB:TO 2134598 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56806.1 LENGTH 139 SQ:AASEQ MSFLLDTNVLSELRKPARAADPGVRAWVAARRPSELYLTVVTVMEIEIGVGRVERRDPAQGKRLRTWLEDDVLDVFAGRILGLDLAAARRAAQWHVPDPRPERDTLIAAIASEHGMTLVTRNVRDFAPMNVPLIDPWGR GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 4->137|Y4JK_RHISN|3e-08|33.9|127/140| SEG 77->92|agrilgldlaaarraa| BL:PDB:NREP 1 BL:PDB:REP 4->137|2h1cA|7e-06|27.6|127/139| RP:PDB:NREP 1 RP:PDB:REP 3->137|2bsqB|3e-15|29.0|131/140| RP:PFM:NREP 1 RP:PFM:REP 4->135|PF01850|6e-06|36.6|123/124|PIN| HM:PFM:NREP 1 HM:PFM:REP 4->129|PF01850|4e-17|27.6|116/126|PIN| RP:SCP:NREP 1 RP:SCP:REP 3->137|2bsqA1|1e-16|28.2|131/138|c.120.1.1| HM:SCP:REP 1->139|2h1cA1|9.6e-27|34.6|133/0|c.120.1.1|1/1|PIN domain-like| OP:NHOMO 103 OP:NHOMOORG 82 OP:PATTERN -------------------------------------------------------------------- -1---------------11-1-----11111-----1-----1----------------------1----------------------------------------------------------------2---------------1-----1-----------2-------------------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------11---11--1111----------1-------11-------113--13-11------------------------12--1-------------1----1-11-11--------1-------1222211--------------1111-21----1-----211--2--2------------14----1----------------1----1-------------------------------------------------------------------------1------------1------------------------------------------------------------------------------1---------------222--------1-----------------------1-----111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 97.8 SQ:SECSTR #EEEEcHHHHTcTTcccGcccHHHHHHHTTccGGGEEEEHHHHHHHHHHHHTccccccHHHHHHHHHHHHTTGGGGTTcEEcccHHHHHHHHHHHHHHHTTTcHHHHHHHHHHTTcEEEcccHHHHHHTTccEEcTT## PSIPRED cEEEEEHHHHHHHHcccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHcccEEEEccHHHHHHccccccccccc //