[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56811.1
DDBJ      :             putative transporter
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:382 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->377 1pw4A_ f.38.1.1 * 1.9e-21 25.5 %
:RPS:PFM   30->76 PF06779 * DUF1228 5e-05 48.9 %
:HMM:PFM   23->102 PF06779 * DUF1228 9.9e-21 40.0 80/85  
:HMM:PFM   334->369 PF11492 * Dicistro_VP4 0.00085 25.0 36/56  
:BLT:SWISS 30->324 YJIJ_ECOLI 2e-17 31.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56811.1 GT:GENE BAD56811.1 GT:PRODUCT putative transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2138998..2140146 GB:FROM 2138998 GB:TO 2140146 GB:DIRECTION + GB:PRODUCT putative transporter GB:PROTEIN_ID BAD56811.1 LENGTH 382 SQ:AASEQ MERPRLAPRGRAIGVAAAAGLAAAMGVGRFVFTPLLPIMTASTGLGAGDGAVIATGNYAGYLVGALLLTRLPQLSRRGTFLAWSLVLIASEAAMAASAQVAVHTALRFAAGVASAAIFIACASTVSRHRAEGASLGVAFAGVGSGIAVTGLFTLLAGPHLSWQGLWIGAAVLTALLLAPAWLLDIRPEIGTDVTGSRPAPGPRERRAWLLLLGAYFAEGVGYIIVGTFLVAAVAGPDTTAATGPALWLVVGLAAAPATVAWHAVARRFGTGRALVAALTVQAVGVAAPALHDGLVAALISALAFGGTFMGVVVLAIDLGNRLPVARPAATLTTLYAVGQVIGPLLVVPVLGSSFTAAFAIAAVIVAVAAALAAGATRAATPS GT:EXON 1|1-382:0| BL:SWS:NREP 1 BL:SWS:REP 30->324|YJIJ_ECOLI|2e-17|31.3|291/100| TM:NTM 12 TM:REGION 11->33| TM:REGION 35->57| TM:REGION 70->92| TM:REGION 106->127| TM:REGION 135->157| TM:REGION 165->187| TM:REGION 210->232| TM:REGION 242->264| TM:REGION 269->291| TM:REGION 298->320| TM:REGION 330->352| TM:REGION 356->378| SEG 7->29|aprgraigvaaaaglaaamgvgr| SEG 89->105|aseaamaasaqvavhta| SEG 108->123|faagvasaaifiacas| SEG 169->183|aavltalllapawll| SEG 230->245|vaavagpdttaatgpa| SEG 253->265|aaapatvawhava| SEG 337->351|vgqvigpllvvpvlg| SEG 355->380|taafaiaavivavaaalaagatraat| RP:PFM:NREP 1 RP:PFM:REP 30->76|PF06779|5e-05|48.9|47/85|DUF1228| HM:PFM:NREP 2 HM:PFM:REP 23->102|PF06779|9.9e-21|40.0|80/85|DUF1228| HM:PFM:REP 334->369|PF11492|0.00085|25.0|36/56|Dicistro_VP4| HM:SCP:REP 1->377|1pw4A_|1.9e-21|25.5|376/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 40 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1----------1-------------------1--------------------------------------------------------------------------------------------------------------------------------1------------1---11--111---------------------1-------------------------------------1---------------------------------------------------------------------------------1-----------------------1-----------------------------------------------------------------1---1------1--------------------------------1--11111---------------111111-111--------------------------------------------------------------------------------------------------------------------------------------------1-1--1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 186-206, 378-382| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccc //