[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56815.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->135 3cu3A PDBj 1e-09 33.3 %
:RPS:PDB   2->144 3cu3A PDBj 2e-09 27.0 %
:RPS:SCOP  2->143 3cu3A1  d.17.4.28 * 7e-07 28.6 %
:HMM:SCOP  1->128 1hkxA_ d.17.4.7 * 2.5e-21 32.3 %
:HMM:PFM   95->121 PF10590 * PNPOx_C 0.00046 32.0 25/42  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56815.1 GT:GENE BAD56815.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2142484..2142921) GB:FROM 2142484 GB:TO 2142921 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56815.1 LENGTH 145 SQ:AASEQ MTTDIDAIHALLARSRDAWRRGDGSAYAACFTTDATDVTYTGTVYRGAAEIGRVHQELFDSFLKGTRLWSEVLDIHRHGPDTAVVVTAGESAARRPRRLGKRVTYTLVRDHDGEWRIAALQKTQRRRVLEGITFLVRPGARPGRR GT:EXON 1|1-145:0| SEG 32->45|ttdatdvtytgtvy| BL:PDB:NREP 1 BL:PDB:REP 2->135|3cu3A|1e-09|33.3|132/160| RP:PDB:NREP 1 RP:PDB:REP 2->144|3cu3A|2e-09|27.0|141/160| HM:PFM:NREP 1 HM:PFM:REP 95->121|PF10590|0.00046|32.0|25/42|PNPOx_C| RP:SCP:NREP 1 RP:SCP:REP 2->143|3cu3A1|7e-07|28.6|140/162|d.17.4.28| HM:SCP:REP 1->128|1hkxA_|2.5e-21|32.3|127/0|d.17.4.7|1/1|NTF2-like| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ----------------1-------------------2--------1------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 99.3 SQ:SECSTR HcHHHHHHHHHHHHHHHHHHTTcHHHHHTTEEEEEEEEcTTccEEEHHHHHHHHHHHHHHTTTTTcEEEEEEEEEEEEETTEEEEEEEcTTcccccGGGccccEEEEEEcETTEEEEEEEEccEccccHHHHHHHHHHHHccHH# DISOP:02AL 95-97, 141-145| PSIPRED ccHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccEEEcccccEEEcHHHHHHHHHHHHHHHHcccEEEEEEEEEEEccccEEEEEEccEEEEcccccccccEEEEEEEEEcccEEEEEEEccccccccccEEEEEccccccccc //