[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56816.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:213 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   83->202 3cu3A PDBj 8e-14 32.8 %
:RPS:PDB   67->210 3cu3A PDBj 3e-12 29.4 %
:RPS:SCOP  67->213 3cu3A1  d.17.4.28 * 2e-10 29.7 %
:HMM:SCOP  59->195 1hkxA_ d.17.4.7 * 1.1e-19 28.7 %
:HMM:PFM   78->128 PF07366 * SnoaL 1.1e-05 27.5 51/126  
:HMM:PFM   10->52 PF10099 * RskA 0.00078 27.9 43/175  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56816.1 GT:GENE BAD56816.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2142946..2143587) GB:FROM 2142946 GB:TO 2143587 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56816.1 LENGTH 213 SQ:AASEQ MLIGDTPGVDAPATPKPRLRRVRRTVGAATALVALSCGGAYLWLDRTAEVRDTGVDHCLDLRPETGTAESLRGVCTTLTAMTEAWNRNDATAFGAVFTENATYTTYLGTHYRGRADLTAAHEALFDGFLAGTKLADAFLDLRFFGDDVAVVTSRGDTYTGERPTDLGKTQTYTMVREADGAWRIASFHNTQRRRALERISFLVAPDTAPAAER GT:EXON 1|1-213:0| SEG 13->35|atpkprlrrvrrtvgaatalval| BL:PDB:NREP 1 BL:PDB:REP 83->202|3cu3A|8e-14|32.8|119/160| RP:PDB:NREP 1 RP:PDB:REP 67->210|3cu3A|3e-12|29.4|143/160| HM:PFM:NREP 2 HM:PFM:REP 78->128|PF07366|1.1e-05|27.5|51/126|SnoaL| HM:PFM:REP 10->52|PF10099|0.00078|27.9|43/175|RskA| RP:SCP:NREP 1 RP:SCP:REP 67->213|3cu3A1|2e-10|29.7|145/162|d.17.4.28| HM:SCP:REP 59->195|1hkxA_|1.1e-19|28.7|136/0|d.17.4.7|1/1|NTF2-like| OP:NHOMO 10 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----------------1-------------------3--------1------------------------------------1------------------------------------------------------------------------------------1-2--------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 70.0 SQ:SECSTR #############################################################cHHHHccHHHHHHHHHHHHHHHHHHTTcHHHHHTTEEEEEEEEcTTccEEEHHHHHHHHHHHHHHTTTTTcEEEEEEEEEEEEETTEEEEEEEEEEcTTcccccGGGccccEEEEEETTEEEEEEEEccEccccHHHHHHHHHHHHccH### DISOP:02AL 1-4, 210-213| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHccccHHHcccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccEEEcccccEEHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEccccEEEEEEEccEEEccccccccccEEEEEEEEccccEEEEEEccccEEEHHHHEEEcccccccccccc //