[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56817.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->90 2a61A PDBj 6e-05 32.8 %
:RPS:PDB   15->135 2a61A PDBj 5e-08 19.8 %
:RPS:SCOP  9->135 2ethA1  a.4.5.28 * 1e-14 23.8 %
:HMM:SCOP  4->139 1jgsA_ a.4.5.28 * 3.2e-21 34.3 %
:HMM:PFM   40->92 PF01047 * MarR 3.5e-14 41.5 53/59  
:BLT:SWISS 1->148 YCGE_BACSU 4e-15 32.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56817.1 GT:GENE BAD56817.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2143681..2144127 GB:FROM 2143681 GB:TO 2144127 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56817.1 LENGTH 148 SQ:AASEQ MSTPDGSAESREVYRRYLSAVVLHAQAGAKACGLGATDLYALNILELSGPMTPGELAARTGLTTGPTTRLIDRLAKDGYVRRVPDAVDRRKVVVEPVGRPAGLDRALAPARRRVAELIAGYSAEERAVLFDYFERAALAYQHAVDEME GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 1->148|YCGE_BACSU|4e-15|32.4|148/154| SEG 56->69|laartglttgpttr| BL:PDB:NREP 1 BL:PDB:REP 33->90|2a61A|6e-05|32.8|58/142| RP:PDB:NREP 1 RP:PDB:REP 15->135|2a61A|5e-08|19.8|121/142| HM:PFM:NREP 1 HM:PFM:REP 40->92|PF01047|3.5e-14|41.5|53/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 9->135|2ethA1|1e-14|23.8|126/140|a.4.5.28| HM:SCP:REP 4->139|1jgsA_|3.2e-21|34.3|134/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 10 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2--------1------------------------------------2--------------------------------------------------------------------------------------------------------------1-------------------11-----------------1-----------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 94.6 SQ:SECSTR ########cHHHHHHHHHHHHHHHHHTTHHHHTccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHTHHHHHc DISOP:02AL 1-5, 142-148| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcc //