Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56818.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:122 amino acids
:HMM:PFM   42->91 PF00903 * Glyoxalase 9.9e-06 24.0 50/128  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56818.1 GT:GENE BAD56818.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2144489..2144857 GB:FROM 2144489 GB:TO 2144857 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56818.1 LENGTH 122 SQ:AASEQ MSFYHFAPALGYLRADLSGIRQPWDEIRMRHLAPRLGYNLRKTIVFTAATTHRIERLLDQVDRHGAEAVFVPGRHHLDGQLEVLREHVGVVIDLDDELRAGPRPRAPRAERGLSGVWKWITG GT:EXON 1|1-122:0| SEG 97->113|elragprprapraergl| HM:PFM:NREP 1 HM:PFM:REP 42->91|PF00903|9.9e-06|24.0|50/128|Glyoxalase| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 102-108| PSIPRED cccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHccccEEEEccHHHHccHHHHHHHHccEEEEccHHHHcccccccccccccHHHHHHHHcc //