[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56819.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  60/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:132 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->118 1npbD PDBj 6e-09 38.6 %
:RPS:PDB   6->122 1ecsA PDBj 4e-09 19.8 %
:RPS:SCOP  4->119 2pjsA1  d.32.1.2 * 3e-11 20.6 %
:HMM:SCOP  1->127 1lqpA_ d.32.1.2 * 4.9e-22 35.0 %
:HMM:PFM   5->118 PF00903 * Glyoxalase 3.9e-12 29.6 108/128  
:BLT:SWISS 21->118 FOSA_SERMA 2e-08 38.6 %
:PROS 97->117|PS00082|EXTRADIOL_DIOXYGENAS
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56819.1 GT:GENE BAD56819.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2145059..2145457 GB:FROM 2145059 GB:TO 2145457 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56819.1 LENGTH 132 SQ:AASEQ MSARFDHTIIAAADRAESAAFYREILELRDAPSWGVFTNLRCADGVLLQFAEPPVDIQFQHYAFLVDDALFDRAYRRLRERGIEHWADPHRRQPGEINHGHGGRGVYFLDPAGHGLEILTRPYLPEVTVEEQ GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 21->118|FOSA_SERMA|2e-08|38.6|88/141| PROS 97->117|PS00082|EXTRADIOL_DIOXYGENAS|PDOC00078| SEG 11->20|aaadraesaa| BL:PDB:NREP 1 BL:PDB:REP 21->118|1npbD|6e-09|38.6|88/137| RP:PDB:NREP 1 RP:PDB:REP 6->122|1ecsA|4e-09|19.8|116/120| HM:PFM:NREP 1 HM:PFM:REP 5->118|PF00903|3.9e-12|29.6|108/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 4->119|2pjsA1|3e-11|20.6|107/111|d.32.1.2| HM:SCP:REP 1->127|1lqpA_|4.9e-22|35.0|117/0|d.32.1.2|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 63 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- --------------111-------11-----111112111-1111--1----1----1-------11111-----------------------------------------------------------------------------11------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------1-------111111-----11--1111-11--111-----1------12---------------------1--------------------------------2--------------------------------------------------------------1-----------------------------------------------------------------------------------------------------1111--------------------------------------------------------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 99.2 SQ:SECSTR GGGcccccEEEEccHHHHHHHHHHTTTcEEEEEcccEEEEEETTEEEEEEEcTTccGGGcccEEEEEEccHHHHHHHHHHTTcccccccccEEEEEEEcTTccEEEEEEcTTccEEEEEEccccccccccE# DISOP:02AL 128-132| PSIPRED cccEEEEEEEEEccHHHHHHHHHHHHccEEEcccccEEEEEEcccEEEEEccccccccccEEEEEccHHHHHHHHHHHHHcccEEEcccccccccccccccccEEEEEEcccccEEEEEEcccccccccccc //