Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56820.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56820.1 GT:GENE BAD56820.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2145485..2145949 GB:FROM 2145485 GB:TO 2145949 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56820.1 LENGTH 154 SQ:AASEQ MRRRYPVLAGAAIVTAGAGLAALVGVDRGDGPVPAAPAVPTPADLEATLVKATDPRVPRAEQIGLVEGDDADGPRLAEGNMVLVTDVPAHRHRVVDVRVAGPDRVIAVTRTSVAGVEIPSTGEVPFVLDAGAWKIEKAWACTVVENLGHRVRAC GT:EXON 1|1-154:0| TM:NTM 1 TM:REGION 6->28| SEG 7->26|vlagaaivtagaglaalvgv| SEG 32->43|pvpaapavptpa| SEG 86->100|dvpahrhrvvdvrva| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHccccccccccHHHHHHHHHcccccEEEEEccEEccccEEEEEEEEEEcccccccccccEEEEEcccEEEEHHHHHHHHHHcccccccc //