[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56821.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:212 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   27->206 3e7jA PDBj 9e-06 14.6 %
:HMM:PFM   115->165 PF11335 * DUF3137 1.1e-05 29.4 51/142  
:HMM:PFM   7->44 PF05425 * CopD 0.00096 31.6 38/105  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56821.1 GT:GENE BAD56821.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2146046..2146684) GB:FROM 2146046 GB:TO 2146684 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56821.1 LENGTH 212 SQ:AASEQ MRDAFVIGLVVFVAVLVVAGLFVLLPMYRRSDRPRRNTFAQWAASHGWHYDEGVRPAWVARLPGRDGGGVAFTLTGVAEGRRVTVAEYGFDTHRFVVVVVHLDRPYPPIAVLDRSLSLQLGDAHYGATPLHTGHAGFDRRFRVTAVDRQYARLMLDPEVVEALLADLVPRWSLAGRDLLTYDLGRLRDPDSVPGLVAPLSRLADLLEERARA GT:EXON 1|1-212:0| TM:NTM 1 TM:REGION 5->27| SEG 4->25|afviglvvfvavlvvaglfvll| RP:PDB:NREP 1 RP:PDB:REP 27->206|3e7jA|9e-06|14.6|164/743| HM:PFM:NREP 2 HM:PFM:REP 115->165|PF11335|1.1e-05|29.4|51/142|DUF3137| HM:PFM:REP 7->44|PF05425|0.00096|31.6|38/105|CopD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 164 STR:RPRED 77.4 SQ:SECSTR ##########################TGGGccHHHHHHHHHHHHHHHTTcTTccccccccccccGGGHHHHTTTTcTH##HHHHHHHHHHHTH##########HHHHHHHGGGcccccHHHHHHHHHHHHHHHHHHHHHHTTcTTHHHHH#TccTTcccc##ccccccccccccccHHHHHHHH#HHHTcHTcccccGGGHHHHHH###### DISOP:02AL 1-2, 211-212| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccEEEEEccccccccEEEEEEEcccccEEEEEEccccccEEEEEEEEcccccccHHHHccccEEEEcccccccccccccccccccEEEEEEHHHHHHHHcccHHHHHHHHHHHcccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcc //