[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56824.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   68->90 PF10414 * CysG_dimeriser 0.00043 34.8 23/60  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56824.1 GT:GENE BAD56824.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2148481..2148831) GB:FROM 2148481 GB:TO 2148831 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56824.1 LENGTH 116 SQ:AASEQ MVEIEVTGTTVTVQVVGGHRLLSLRERLTFDLRDIAAVGPASVDLRPPWVRAPGTFFPGVIAAGTFRGKGRKEFWDTRFDGSAVQIELTGGEFTRLVVDVDEPDSTLRALRRAAAA GT:EXON 1|1-116:0| SEG 6->18|vtgttvtvqvvgg| SEG 107->115|lralrraaa| HM:PFM:NREP 1 HM:PFM:REP 68->90|PF10414|0.00043|34.8|23/60|CysG_dimeriser| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 115-116| PSIPRED cEEEEEEccEEEEEEEEHHHHHEEHHHEEEcHHHHHEEccccccccccccccccccccEEEEEEEEEEcccEEEEEEEccccEEEEEEcccEEEEEEEEEccHHHHHHHHHHHHcc //