[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56827.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->71 3bxoA PDBj 2e-04 47.3 %
:RPS:PDB   13->131 3a25A PDBj 9e-07 11.5 %
:RPS:SCOP  24->146 1im8A  c.66.1.14 * 3e-09 26.2 %
:HMM:SCOP  12->177 1r74A_ c.66.1.5 * 2.7e-15 22.7 %
:HMM:PFM   29->128 PF07021 * MetW 1e-08 27.3 99/193  
:BLT:SWISS 7->120 TAM_MYCTU 1e-04 36.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56827.1 GT:GENE BAD56827.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2152877..2153476 GB:FROM 2152877 GB:TO 2153476 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56827.1 LENGTH 199 SQ:AASEQ MSTSLIYRNRAVYELMMRGLYGRHYAARYRAIAELVPEGADVLDVCCGPATLYTRYLRHRNVRYTGLDLNEKFVAGVTRAGGAGRVWNMRSSQPLPPADVVIMQASLYHFLPDAAPVLDRMLAAARERVVLAEPVRNLATSRNRLLALIGQRFTDAGDGSQAHRFTEASLADLMRGYRARIVRDELIAGGREKLYVLAT GT:EXON 1|1-199:0| BL:SWS:NREP 1 BL:SWS:REP 7->120|TAM_MYCTU|1e-04|36.1|97/261| SEG 74->86|vagvtraggagrv| BL:PDB:NREP 1 BL:PDB:REP 12->71|3bxoA|2e-04|47.3|55/236| RP:PDB:NREP 1 RP:PDB:REP 13->131|3a25A|9e-07|11.5|113/264| HM:PFM:NREP 1 HM:PFM:REP 29->128|PF07021|1e-08|27.3|99/193|MetW| RP:SCP:NREP 1 RP:SCP:REP 24->146|1im8A|3e-09|26.2|122/226|c.66.1.14| HM:SCP:REP 12->177|1r74A_|2.7e-15|22.7|163/0|c.66.1.5|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 194 STR:RPRED 97.5 SQ:SECSTR ###ccHHHHHHHEETTTccccGGGHHHHHHHHHHHccTTcEEEETTcTTTTTHHHHHHHTccEEEEEcccHHHHHHHHHHHHHTTcTTGGGccccccEEEEEEEEEcGcccccGGGGHHHHHHHEEEEEEEEEccccHHHHHHHHHHHHHcTTHHHHHHHHccHHHHHHHHHHHHHHTcccEEEEEETTEEEEEEcc## DISOP:02AL 1-3| PSIPRED cccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHcccEEEEEcccHHHHHHHHHcccccEEEccccccccccccEEEHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEc //