[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56831.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:157 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   28->119 PF04138 * GtrA 2e-08 43.7 %
:HMM:PFM   28->144 PF04138 * GtrA 5.9e-23 27.2 114/117  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56831.1 GT:GENE BAD56831.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2158173..2158646 GB:FROM 2158173 GB:TO 2158646 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56831.1 LENGTH 157 SQ:AASEQ MSTGLDPTSGAGAVAALRRVLRRQEVGFALIGGFNTVLGMVLTVAWLTVLPDRPWAPSAAVALAYAIGITVAFVLHRTLVFRVRGRVLRDFLGFVAVNSGGLVLNMALLSLAVSVCGLPEKPSAVVVMGVVAVASFFGHRHISFRRRPVAAPDEPVG GT:EXON 1|1-157:0| TM:NTM 4 TM:REGION 27->49| TM:REGION 56->78| TM:REGION 90->112| TM:REGION 123->140| SEG 10->23|gagavaalrrvlrr| SEG 124->134|avvvmgvvava| RP:PFM:NREP 1 RP:PFM:REP 28->119|PF04138|2e-08|43.7|87/116|GtrA| HM:PFM:NREP 1 HM:PFM:REP 28->144|PF04138|5.9e-23|27.2|114/117|GtrA| GO:PFM:NREP 3 GO:PFM GO:0000271|"GO:polysaccharide biosynthetic process"|PF04138|IPR007267| GO:PFM GO:0006810|"GO:transport"|PF04138|IPR007267| GO:PFM GO:0016021|"GO:integral to membrane"|PF04138|IPR007267| OP:NHOMO 7 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------1-----------22-----------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 5-7, 151-157| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccEEEccccccccccc //