[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56832.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.171.1
:76 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->61 2jnyA PDBj 9e-13 59.6 %
:RPS:SCOP  8->66 2hf1A1  b.171.1.1 * 3e-10 42.9 %
:HMM:PFM   8->50 PF03966 * Trm112p 6.7e-13 46.5 43/68  
:BLT:SWISS 7->66 Y2306_ACISJ 4e-11 52.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56832.1 GT:GENE BAD56832.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2158657..2158887 GB:FROM 2158657 GB:TO 2158887 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56832.1 LENGTH 76 SQ:AASEQ MSERTVLDPTLLELLACPQDKGPLLLVRDNAGADVLYNPRLRRAYPIENGIPVLLVDEARDVADDEHAALVAQQRD GT:EXON 1|1-76:0| BL:SWS:NREP 1 BL:SWS:REP 7->66|Y2306_ACISJ|4e-11|52.6|57/60| BL:PDB:NREP 1 BL:PDB:REP 7->61|2jnyA|9e-13|59.6|52/61| HM:PFM:NREP 1 HM:PFM:REP 8->50|PF03966|6.7e-13|46.5|43/68|Trm112p| RP:SCP:NREP 1 RP:SCP:REP 8->66|2hf1A1|3e-10|42.9|56/59|b.171.1.1| OP:NHOMO 40 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- ------11111111-1111-11111111-11111111111---------------------------1----------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1----------------------------------------------------------------------------111-----1-----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 64 STR:RPRED 84.2 SQ:SECSTR ######ccGGGTcccccTTTccccEEETTTcTTTEEEETTTTEEEEEETTEEcccccccEEccHHHHHTT###### DISOP:02AL 1-5, 73-76| PSIPRED ccccccccHHHHHHHccccccccEEEccccccccEEEccccccccccccccccccHHHcccccccHHHHHHHHccc //