[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56833.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:203 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->197 2np3B PDBj 3e-23 39.1 %
:RPS:PDB   21->198 2dg7A PDBj 5e-13 17.5 %
:RPS:SCOP  21->70 1z77A1  a.4.1.9 * 2e-14 38.0 %
:RPS:SCOP  88->197 2np3A2  a.121.1.1 * 4e-12 26.5 %
:HMM:SCOP  7->95 1t33A1 a.4.1.9 * 2.2e-15 31.8 %
:HMM:SCOP  88->199 2np3A2 a.121.1.1 * 4.8e-27 43.6 %
:RPS:PFM   23->69 PF00440 * TetR_N 1e-06 46.8 %
:HMM:PFM   23->69 PF00440 * TetR_N 9.8e-18 40.4 47/47  
:BLT:SWISS 21->95 BETI_AGRT5 2e-08 45.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56833.1 GT:GENE BAD56833.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2158906..2159517) GB:FROM 2158906 GB:TO 2159517 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56833.1 LENGTH 203 SQ:AASEQ MSSTGAGRGAGRRPGRSGARQAILDAARVRFAEHGFDRTSIRAVAADAGVDPALVHHYFGTKQQLFTAVVDLPVDPEAVLAVIDATPVEQLGATIIRAVTAIWDSPAGPAVVAVARTLLTGAEPALARTFVLEVVLERVRRRIATDTDDGRARVALTASQMMGIMVARKIIGVEPLASMPLDELAAAVGPTLQRYLTGDLGSA GT:EXON 1|1-203:0| BL:SWS:NREP 1 BL:SWS:REP 21->95|BETI_AGRT5|2e-08|45.2|73/206| SEG 2->20|sstgagrgagrrpgrsgar| SEG 131->142|vlevvlervrrr| BL:PDB:NREP 1 BL:PDB:REP 22->197|2np3B|3e-23|39.1|161/174| RP:PDB:NREP 1 RP:PDB:REP 21->198|2dg7A|5e-13|17.5|177/185| RP:PFM:NREP 1 RP:PFM:REP 23->69|PF00440|1e-06|46.8|47/47|TetR_N| HM:PFM:NREP 1 HM:PFM:REP 23->69|PF00440|9.8e-18|40.4|47/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 21->70|1z77A1|2e-14|38.0|50/75|a.4.1.9| RP:SCP:REP 88->197|2np3A2|4e-12|26.5|102/104|a.121.1.1| HM:SCP:REP 7->95|1t33A1|2.2e-15|31.8|88/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 88->199|2np3A2|4.8e-27|43.6|110/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 90 OP:NHOMOORG 62 OP:PATTERN -------------------------------------------------------------------- ----2-------1-21111-12--841111143222112212---1-1-11-1----1--11111112211-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---------1----1--1---------------------1---------------1---------------------------------------------------------------------211-111--------------2-1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 90.1 SQ:SECSTR ####################HHHHHHHHHHHHHccGGGccHHHHHHHTTccHHHHHHHcccTTGGGTTTcccHcHHHHHHHHHTccTTccHHHHHHHHHHHTTTTTTccTTHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHcHHTTT DISOP:02AL 1-22| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccc //