[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56835.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:243 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   7->220 3fvqB PDBj 3e-26 34.6 %
:RPS:PDB   8->220 3b5jA PDBj 5e-41 26.5 %
:RPS:SCOP  10->234 1b0uA  c.37.1.12 * 5e-40 31.7 %
:HMM:SCOP  12->211 1ii8.1 c.37.1.12 * 1.4e-63 39.7 %
:RPS:PFM   36->69 PF03205 * MobB 6e-04 35.3 %
:RPS:PFM   49->162 PF00005 * ABC_tran 2e-16 41.6 %
:HMM:PFM   49->162 PF00005 * ABC_tran 1.1e-24 38.9 108/118  
:HMM:PFM   40->57 PF05729 * NACHT 0.00015 44.4 18/166  
:BLT:SWISS 10->237 YBHF_SHIFL 2e-42 38.6 %
:PROS 135->149|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56835.1 GT:GENE BAD56835.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2160275..2161006) GB:FROM 2160275 GB:TO 2161006 GB:DIRECTION - GB:PRODUCT putative ABC transporter ATP-binding protein GB:PROTEIN_ID BAD56835.1 LENGTH 243 SQ:AASEQ MSRPSPTPAVDVRDLVVHRGGRPVLHGVSLTIPSGTITGLLGPSGCGKTTLMRSIVGTQQVRSGRISALGLPAGAAELRRRIGYVTQAPSIYNDISVRENVAYFAALYGRDRAEVDEALTAVGLREHAHHRGDELSGGQKTRASLACALVARPELLILDEPTVGLDPVLRVELWKQFHELAAAGTTLLVSSHVMDEAEHCDRLLLMREGRLLAELSPDELRARTGQDNLEKAFLTLITMGQHA GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 10->237|YBHF_SHIFL|2e-42|38.6|228/578| PROS 135->149|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 7->220|3fvqB|3e-26|34.6|214/350| RP:PDB:NREP 1 RP:PDB:REP 8->220|3b5jA|5e-41|26.5|211/243| RP:PFM:NREP 2 RP:PFM:REP 36->69|PF03205|6e-04|35.3|34/139|MobB| RP:PFM:REP 49->162|PF00005|2e-16|41.6|113/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 49->162|PF00005|1.1e-24|38.9|108/118|ABC_tran| HM:PFM:REP 40->57|PF05729|0.00015|44.4|18/166|NACHT| GO:PFM:NREP 4 GO:PFM GO:0005525|"GO:GTP binding"|PF03205|IPR004435| GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF03205|IPR004435| GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 10->234|1b0uA|5e-40|31.7|224/258|c.37.1.12| HM:SCP:REP 12->211|1ii8.1|1.4e-63|39.7|199/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 54634 OP:NHOMOORG 1173 OP:PATTERN XXMBSNEKUSSOTOTOnKUTOTSa*OSjkbeVJADDECIGHGBWdPZoMS*zd8PcRXbQRIJEc199 YdzR*kinttweiWcWbRQ-QsCCd*RRRRRS*zz*****W*g****o*qlV***WboGG***r******gdXXX*ebeS*joDBB8CSRRO6MFKG--EFSLMMeObWT77777879A9AAAAIWSLUZNNUXdTuz***LJL*fzps*ihogkVWRNSLSNkicr***cHSJNHGJTIMIFqcjVSogBhj*************************lv***qvx**wwx**ZllkkkiijikkljhaeXbd*ggg**fQgYk*zQR**hXUZplfgiqquz*v****twstppuyqtueeedcedeheddd*wtkjkwvyss*y*********l*ns***dnnk*tizu*quWL**ricgjkVdiYlsQYciOgcYYQNQQNRec***fay****************-z**uq*****UA**************JQN**********cbccccccxglOVph*88866666577888BC88AA9888986A6JFGIGI************************t********BR**y*r*rv******dstRZKTpdLMKKMKLXUSgzkfz*TdZ*octuifrLdadWXbmZbdefe**b*GKLSDKKKLHEACABBACABHSEGJUTvwwR*YhNXOwUZcdZRWeZXYYUZfcbae5-FObUP331222****c************-*************wwzxvv*****nqipqmnpqqqqqonqnnq*vosvvtvY4************55JIDFCDEQRSQVN*s*bbbYYYJPSONTOThPRTSRJTLSWzh*************q***DBB9BCCABMipo*uvvvv*****VXWWTXWTUUIGHG76NRQQJJJK77777877*EbB8AAE-89A7ED9HIF7BJC89558VlpRSi*kokEjO 1255uqQ-sSBGZiZQOSLVbgbljqYOOHJHJYVTIRNOKPPJKHUTUdgeviTTUINMMOIBEACA4DDACGHDG4EGJDABIK89-TeFOKJJJEJJHAKVTN8c*u*ephyjyPKKKRcP*yH*K**y4*b*PSMIpOT*iJULNHoHG*KjYY*Pu*T*UnP*jv*soyYLaTJ*NJHab****Q**RQ****v ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 240-243| PSIPRED ccccccccEEEEEccEEEEccEEEEccccEEEcccEEEEEEccccccHHHHHHHHHHcccccccEEEEEcccccHHHHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHcccHHHHcccHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHcEEEEEEccEEEEEccHHHHHHHccccHHHHHHHHHHcccccc //