[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56836.1
DDBJ      :             putative 3-methylpurine DNA glycosylase
Swiss-Prot:3MGH_NOCFA   RecName: Full=Putative 3-methyladenine DNA glycosylase;         EC=3.2.2.-;

Homologs  Archaea  3/68 : Bacteria  264/915 : Eukaryota  40/199 : Viruses  0/175   --->[See Alignment]
b.46.1
:212 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->138 1f4rA PDBj 4e-13 42.6 %
:RPS:PDB   1->199 1bnkA PDBj 1e-24 33.7 %
:RPS:SCOP  1->199 1bnkA  b.46.1.2 * 5e-25 33.7 %
:HMM:SCOP  1->203 1ewnA_ b.46.1.2 * 2.6e-54 41.8 %
:RPS:PFM   17->192 PF02245 * Pur_DNA_glyco 2e-27 47.3 %
:HMM:PFM   12->191 PF02245 * Pur_DNA_glyco 4.5e-59 48.5 171/184  
:BLT:SWISS 1->212 3MGH_NOCFA e-104 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56836.1 GT:GENE BAD56836.1 GT:PRODUCT putative 3-methylpurine DNA glycosylase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2161117..2161755 GB:FROM 2161117 GB:TO 2161755 GB:DIRECTION + GB:PRODUCT putative 3-methylpurine DNA glycosylase GB:PROTEIN_ID BAD56836.1 LENGTH 212 SQ:AASEQ MAVVSVEELVVDPPTAARRLLGATLRSGQVAVRLVEVEAYGGDAEGPWPDPASHSGRGRTKRNAVMFGPAGYLYVYLSYGMHTCVNVTTGPDGTAGAVLLRAGEVVDGLDVVRGRRPTARTDADLARGPGNFGTALGIALDDYGTALFDPAAPIRLELADPLPAALIADGPRVGVSSEADRPWRFWLPSSPAVSAYRRSPRAPGAATVRAPR GT:EXON 1|1-212:0| SW:ID 3MGH_NOCFA SW:DE RecName: Full=Putative 3-methyladenine DNA glycosylase; EC=3.2.2.-; SW:GN OrderedLocusNames=NFA_19900; SW:KW Complete proteome; DNA damage; DNA repair; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->212|3MGH_NOCFA|e-104|100.0|212/212| GO:SWS:NREP 3 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| SEG 105->116|vvdgldvvrgrr| SEG 156->169|leladplpaaliad| BL:PDB:NREP 1 BL:PDB:REP 17->138|1f4rA|4e-13|42.6|115/199| RP:PDB:NREP 1 RP:PDB:REP 1->199|1bnkA|1e-24|33.7|184/200| RP:PFM:NREP 1 RP:PFM:REP 17->192|PF02245|2e-27|47.3|169/185|Pur_DNA_glyco| HM:PFM:NREP 1 HM:PFM:REP 12->191|PF02245|4.5e-59|48.5|171/184|Pur_DNA_glyco| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF02245|IPR003180| GO:PFM GO:0003905|"GO:alkylbase DNA N-glycosylase activity"|PF02245|IPR003180| GO:PFM GO:0006284|"GO:base-excision repair"|PF02245|IPR003180| RP:SCP:NREP 1 RP:SCP:REP 1->199|1bnkA|5e-25|33.7|184/200|b.46.1.2| HM:SCP:REP 1->203|1ewnA_|2.6e-54|41.8|196/214|b.46.1.2|1/1|FMT C-terminal domain-like| OP:NHOMO 332 OP:NHOMOORG 307 OP:PATTERN ----------------------------------------------1-------------------11 111111-111111111111-11111111111111111111111111--1111111111--1111111111--------1---1-------------1--1-----1--11-------1111111-11111111-11---------1---1---1111111111--11---1-1-1---2-11--1--------11111111111111111-11-1111----111111111-----------------1----------------------------------------------------------------1-----------11-------------111-------------11111---1--------1-11--1------111111111111------------1131111111--111111111111--------1111---------------1------11111--111-111111111111111------------1111------1-11------1-1--------------------1----------------11------------------111------111111--------------------------------------------------------------1----------------------------------------------------------------------------------------------2------1111-------------------------------1------------------11-1-111---------------1-1111111-------------------1------------------------------------------1- --------1-------------------------------------------------------------------------------------------------2---211111-1--1-1112-1-663-213-1--2--11-1--11--1--1--111-1----------2-----------111-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 87.7 SQ:SECSTR TTcccHHHHcccHHHHHHHHTTcEEEEEcEEEEEEEEEEEccTT#####cTTcTTGGGccTTGGGGGccTTcEEEEEETTTEEEEEEEcEcccTTcEEEEEEEEEEEcHHHHHHHHcccccTHHHHccHHHHHHHTTccGGGTTccTTccc########cEEEEccEEEEcccccGGGGccccEEEETTcTTcccccHH############# DISOP:02AL 196-212| PSIPRED cccccHHHHcccHHHHHHHHccEEEEcccEEEEEEEEEEccccccccccccccccccccccccHHHHcccccEEHHHHHHHHEEEEEEEcccccccEEEEEEcccHHHHHHHHHHcccccccHHHHccHHHHHHHHcccHHHcccccccccccEEEEcccccccccEEEEccccccccccccEEEEEccccEEccccccccccccccccccc //