[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56839.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  67/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.118.8
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   35->166 2cfuA PDBj 3e-08 14.5 %
:RPS:SCOP  35->157 1ya0A1  a.118.8.1 * 7e-05 16.2 %
:HMM:PFM   137->159 PF07721 * TPR_4 0.00089 34.8 23/26  
:HMM:PFM   3->66 PF07219 * HemY_N 0.00034 31.1 61/134  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56839.1 GT:GENE BAD56839.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2170344..2170898 GB:FROM 2170344 GB:TO 2170898 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56839.1 LENGTH 184 SQ:AASEQ MAVRLLDDDPRLALAHARAARQRAGRIAVVRETAGVVAYHAGEWAEALSELRTARRMSGGSGLLAVMADCERGLGRPERAIELGRSDEARALTGDEASELRIVVAGARMDLGQYDQAVVTLQTDDLDPERTGSSAARLFYAYADALVAAGRTAEGLEWFLNAAAADLDGETDAEDRAAELTGDA GT:EXON 1|1-184:0| SEG 2->31|avrlldddprlalaharaarqragriavvr| RP:PDB:NREP 1 RP:PDB:REP 35->166|2cfuA|3e-08|14.5|124/627| HM:PFM:NREP 2 HM:PFM:REP 137->159|PF07721|0.00089|34.8|23/26|TPR_4| HM:PFM:REP 3->66|PF07219|0.00034|31.1|61/134|HemY_N| RP:SCP:NREP 1 RP:SCP:REP 35->157|1ya0A1|7e-05|16.2|117/458|a.118.8.1| OP:NHOMO 68 OP:NHOMOORG 68 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11--1111111111111111111111111111111--1--111111111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 71.7 SQ:SECSTR ##################################cccccGGGTccccHHHHHHHHHHTTcHHHHHHHHHHHHHTTcHHHHHHHHHTcHHHHHcTTcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHTTcHHHHccccccccHHHHHHccHHHHHHHHHHHcc################## DISOP:02AL 183-184| PSIPRED cEEHHHHccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHcccc //