Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56841.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56841.1 GT:GENE BAD56841.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2171933..2172199 GB:FROM 2171933 GB:TO 2172199 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56841.1 LENGTH 88 SQ:AASEQ MTTPTNAPRPGVPLPGQHLPGAQGRPEPADPDRIRAEIDELLAELDAGGGRPGPAEHAETGADITRRARILEQAHEVLVQALATVDKI GT:EXON 1|1-88:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 19-31| PSIPRED ccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcc //