[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56845.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:140 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   5->139 3cnwB PDBj 2e-13 13.2 %
:RPS:SCOP  1->137 2rerA1  d.129.3.6 * 5e-15 16.1 %
:HMM:SCOP  1->142 1t17A_ d.129.3.6 * 5.1e-21 28.4 %
:RPS:PFM   10->131 PF10604 * Polyketide_cyc2 5e-07 31.4 %
:HMM:PFM   1->133 PF10604 * Polyketide_cyc2 4.2e-18 27.8 126/139  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56845.1 GT:GENE BAD56845.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2175771..2176193) GB:FROM 2175771 GB:TO 2176193 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56845.1 LENGTH 140 SQ:AASEQ MPRSTVEAVIPAPRQAVYTFFVNRDGINPFLPGVQFTLKKPGTDSPSGVGAQYTVGRGSIGFVEETTTLVPNERFEYKIVKGVPVKRHVGIVTFADAEGGTRVTYTMESEPSLPVPAKVLEAGLRTLIGQIMGATKKAFA GT:EXON 1|1-140:0| RP:PDB:NREP 1 RP:PDB:REP 5->139|3cnwB|2e-13|13.2|129/137| RP:PFM:NREP 1 RP:PFM:REP 10->131|PF10604|5e-07|31.4|121/141|Polyketide_cyc2| HM:PFM:NREP 1 HM:PFM:REP 1->133|PF10604|4.2e-18|27.8|126/139|Polyketide_cyc2| RP:SCP:NREP 1 RP:SCP:REP 1->137|2rerA1|5e-15|16.1|137/155|d.129.3.6| HM:SCP:REP 1->142|1t17A_|5.1e-21|28.4|141/0|d.129.3.6|1/1|Bet v1-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEEcccHHHHHHHHccTTcHHHHcTTcccEEEEGGGTTcTcEEEEccTTcccEEEEEEEEEETTTTEEEEEEEccccEEEEEEEEEEcccTTcEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 1-3| PSIPRED ccccEEEEEccccHHHHHHHHHccccccccccccEEEEEEccccccccEEEEEEcccccccEEEEEEEEEcccEEEEEEccccccHHHccEEEEEEcccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcc //