[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56850.1
DDBJ      :             putative channel protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:315 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->204,270->308 PF11382 * DUF3186 2e-28 44.7 %
:HMM:PFM   2->310 PF11382 * DUF3186 6.3e-102 50.7 304/308  
:BLT:SWISS 2->197 OMP1_MYCTU 2e-28 38.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56850.1 GT:GENE BAD56850.1 GT:PRODUCT putative channel protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2180571..2181518 GB:FROM 2180571 GB:TO 2181518 GB:DIRECTION + GB:PRODUCT putative channel protein GB:PROTEIN_ID BAD56850.1 LENGTH 315 SQ:AASEQ MMISLRQHAISIVAIFLALAIGVVLGSQTLAADLLSGLRADKTELGRQVDDLGARNRALTDQVDAADRFIASSAGRILGGTLADRSVLVFTTPDADPADVEAVSTGLQTAGAAVAGRIALTDAFVDAAEGDRLRTAVTNTIPAGAQLRTGGVDQGSLAGDLLGMVLLLDPATGQPRSTPQELSLVLETLRGGGFLAYGDTPVQPAQLAVVVTGAGAQAAENARGANVARFAGALRGRGAGVVLAGRTGAADGQGALAIVRSDAALAAALTTVDNLDREIGRVTTVLGLTEQLGGGAGRYGTGPQAGSLTLAGLPG GT:EXON 1|1-315:0| BL:SWS:NREP 1 BL:SWS:REP 2->197|OMP1_MYCTU|2e-28|38.3|196/314| TM:NTM 1 TM:REGION 10->32| SEG 157->169|lagdllgmvllld| SEG 205->250|aqlavvvtgagaqaaenarganvarfagalrgrgagvvlagrtgaa| SEG 255->269|alaivrsdaalaaal| RP:PFM:NREP 1 RP:PFM:REP 2->204,270->308|PF11382|2e-28|44.7|238/304|DUF3186| HM:PFM:NREP 1 HM:PFM:REP 2->310|PF11382|6.3e-102|50.7|304/308|DUF3186| OP:NHOMO 41 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- ----111111111-11111-11111-11111111111111----11--1-----------11--1-1---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cEEEHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEEEEEcccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccEEcccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEccccccccccEEEEEEccHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccccccEEEEccccc //