[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56855.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  109/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:306 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  221->288 1w1wE  a.4.5.57 * 4e-09 15.6 %
:RPS:PFM   55->286 PF02616 * ScpA_ScpB 6e-11 27.2 %
:HMM:PFM   55->289 PF02616 * ScpA_ScpB 1.2e-48 33.2 223/242  
:BLT:SWISS 40->121 SCPA_CLOPS 2e-13 45.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56855.1 GT:GENE BAD56855.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2186113..2187033 GB:FROM 2186113 GB:TO 2187033 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56855.1 LENGTH 306 SQ:AASEQ MSAATDPAPPTVPDPHEPVPANAQAEGDGESGGESGGFRLKLANFEGPFDLLLTLISSRKLDVTEVALHQVTDEFIAYTKALTASMETTAGLRADKILDQTTEFLVVAATLLDLKAARLLPSGEMTDAEDLELLEARDLLFARLLQYRAFKQVAELLGELEAVALRRYPRAVGLEERFAGLLPEVTLGVDAAGFAEIAAAAFRPRPRPTVGLDHLHQHTVSVAEQAALVLEMLKARGPGGWTTFAELVADCEVPVQIVARFLALLELYRGKSIEFDQPDPLGPLAISWIGDPGEQDTTVTIEEDYG GT:EXON 1|1-306:0| BL:SWS:NREP 1 BL:SWS:REP 40->121|SCPA_CLOPS|2e-13|45.1|71/248| SEG 3->21|aatdpapptvpdphepvpa| SEG 26->37|egdgesggesgg| SEG 127->145|daedlelleardllfarll| SEG 153->165|vaellgeleaval| SEG 191->208|aagfaeiaaaafrprprp| RP:PFM:NREP 1 RP:PFM:REP 55->286|PF02616|6e-11|27.2|213/220|ScpA_ScpB| HM:PFM:NREP 1 HM:PFM:REP 55->289|PF02616|1.2e-48|33.2|223/242|ScpA_ScpB| RP:SCP:NREP 1 RP:SCP:REP 221->288|1w1wE|4e-09|15.6|64/70|a.4.5.57| OP:NHOMO 109 OP:NHOMOORG 109 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11111111111111111111111111-111111111-1--111-1111111----111--11-------------------------------------------1-----------------------------------------------------------------11----------------1--------111--1-------11---------------------1------------------1-------------------------------------------------1111-11111111111-111111111-------11--------11-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 22-23, 26-31, 300-303| PSIPRED ccccccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEccccHHHHHHHHHHHHHHccccccEEHHHHHcccccHHHHHHHHHHHHHHHHccEEEEEEccccccEEEEEccccccccccccHHHHcc //