[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56857.1
DDBJ      :             putative pseudouridine synthase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  863/915 : Eukaryota  31/199 : Viruses  0/175   --->[See Alignment]
d.265.1d.66.1
:237 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->235 3dh3C PDBj 2e-19 32.1 %
:RPS:PDB   2->235 3dh3B PDBj 2e-32 27.7 %
:RPS:SCOP  2->39 1kskA3  d.66.1.5 * 4e-07 36.8 %
:RPS:SCOP  61->231 1kskA4  d.265.1.3 * 2e-34 35.8 %
:HMM:SCOP  1->63 1jh3A_ d.66.1.4 * 4e-08 37.1 %
:HMM:SCOP  39->237 1przA_ d.265.1.3 * 4.5e-43 40.1 %
:RPS:PFM   61->189 PF00849 * PseudoU_synth_2 9e-15 48.0 %
:HMM:PFM   58->192 PF00849 * PseudoU_synth_2 8.2e-26 34.1 135/164  
:HMM:PFM   2->39 PF01479 * S4 3.9e-11 39.5 38/48  
:BLT:SWISS 1->237 Y1738_MYCBO 9e-75 64.8 %
:PROS 98->112|PS01149|PSI_RSU
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56857.1 GT:GENE BAD56857.1 GT:PRODUCT putative pseudouridine synthase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2188204..2188917 GB:FROM 2188204 GB:TO 2188917 GB:DIRECTION + GB:PRODUCT putative pseudouridine synthase GB:PROTEIN_ID BAD56857.1 LENGTH 237 SQ:AASEQ MLAKAGVASRRAAEEMIDQGRVEVDGVIVREQGLRIDPQTAVVRVDGVRVVVRDEQVYVALNKPKGWQSTMSDDLGRPCVGDIVAERIAAGQRLFHVGRLDADTEGLLLLTNDGDLAHRLMHPSFEVSKTYLATVHGEVHHKVIGKRLRDGIELEDGPAKVDRFQVLELGEGRSLVKIVLHEGRKHIVRRLLDAVGHPVTRLVRTHIGPVALGDQRPGTLRVLGRDEIGKLYEAVSL GT:EXON 1|1-237:0| BL:SWS:NREP 1 BL:SWS:REP 1->237|Y1738_MYCBO|9e-75|64.8|236/254| PROS 98->112|PS01149|PSI_RSU|PDOC00885| SEG 42->59|vvrvdgvrvvvrdeqvyv| BL:PDB:NREP 1 BL:PDB:REP 2->235|3dh3C|2e-19|32.1|212/239| RP:PDB:NREP 1 RP:PDB:REP 2->235|3dh3B|2e-32|27.7|224/241| RP:PFM:NREP 1 RP:PFM:REP 61->189|PF00849|9e-15|48.0|127/149|PseudoU_synth_2| HM:PFM:NREP 2 HM:PFM:REP 58->192|PF00849|8.2e-26|34.1|135/164|PseudoU_synth_2| HM:PFM:REP 2->39|PF01479|3.9e-11|39.5|38/48|S4| GO:PFM:NREP 4 GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF00849|IPR006145| GO:PFM GO:0003723|"GO:RNA binding"|PF00849|IPR006145| GO:PFM GO:0009451|"GO:RNA modification"|PF00849|IPR006145| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF00849|IPR006145| RP:SCP:NREP 2 RP:SCP:REP 2->39|1kskA3|4e-07|36.8|38/59|d.66.1.5| RP:SCP:REP 61->231|1kskA4|2e-34|35.8|165/172|d.265.1.3| HM:SCP:REP 1->63|1jh3A_|4e-08|37.1|62/99|d.66.1.4|1/1|Alpha-L RNA-binding motif| HM:SCP:REP 39->237|1przA_|4.5e-43|40.1|197/252|d.265.1.3|1/1|Pseudouridine synthase| OP:NHOMO 1906 OP:NHOMOORG 894 OP:PATTERN -------------------------------------------------------------------- 1221111111111111111-11111111111111111111111111111111111111--11111111111-1111111111121222111111-11--21333132312-1111111-11111111111111111111111111112122222122222122122222221211111211111111122-222-4444444344444422222244522232332222223332222222222222222222-11211211112211112222212333333333322322333222233333333333333333333333323323222222242422224344232122221111121111222222-22111333311111121111111111111111111111-3322222112112111222222221144122111112221111111111111222------------1111111111111-----1212-22222322323333333332333332333333333222333443321224334344433343333222334211131111111111111111211111131112111-1111111-11111112111133442344524545555456644445-56466--2111211111143332444443444444-4444444444444444444444333344444444444444443544434442-433343333444--2111111222223234222323232223322222222233322333333322-3333223111111111354444444444544445555555511111112221111111111112-311111-21111--1111---12---2112211111122 11--22--311-------------------------------------------------------------------------------------------------52-----------------------------------------------------2---------1-1-13A212-111-1-114332222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 235 STR:RPRED 99.2 SQ:SECSTR HHHTTTcccHHHHHHHHHTTcEEETTEEccTTcEEcccccEEETTEEEccccGGGccEEEEEEcTTcccccccccTTcHHHHHTcEHHTcccccEEccccccccEEEEEEEccTHHHHHHHcGGGcccEEEEEEEcccccHHHHHHHHHTccccccccccccEEEEccEEEcccEEEEEEccccTTHHHHHHHHTTccEEEEEEEEETTEEcTTccTTcEEEccHHHHHHHHHTc## DISOP:02AL 4-7| PSIPRED cHHccccHHHHHHHHHHHcccEEEccEEccccccEEccccEEEEEcccccEEccccEEEEEEccccEEEEcccccccHHHHHHHHHHHccccccEEEccccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEEEccccHHHHHHHHHcccccccccccEEEEEEEEEcccEEEEEEEEEcccHHHHHHHHHHHccEEEEEEEEEEccEEcccccccccccccHHHHHHHHHHHcc //