[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56860.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:252 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   168->216 2fujA PDBj 5e-04 47.8 %
:RPS:PDB   17->232 3b7kC PDBj 3e-09 10.4 %
:RPS:SCOP  17->90 2essA1  d.38.1.8 * 3e-08 17.6 %
:RPS:SCOP  159->250 2essA2  d.38.1.8 * 8e-08 14.1 %
:HMM:SCOP  12->144 2cyeA1 d.38.1.1 * 4.1e-16 22.9 %
:HMM:SCOP  157->224 2essA2 d.38.1.8 * 2.3e-10 32.4 %
:RPS:PFM   17->222 PF01643 * Acyl-ACP_TE 1e-10 27.7 %
:HMM:PFM   17->225 PF01643 * Acyl-ACP_TE 3.2e-33 19.7 203/249  
:BLT:SWISS 11->252 Y2001_MYCTU 8e-45 39.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56860.1 GT:GENE BAD56860.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2191129..2191887 GB:FROM 2191129 GB:TO 2191887 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56860.1 LENGTH 252 SQ:AASEQ MVIPRVLAPCPTDYTPFSTHWPVRLADTDREQRLRLDAVARYLQDIGFEHLDAVADGANHRGWVVRRTVIDVLEPVRWGEHVTLSRWCSALSNRWCNMRVRIEGSGGGSIETEAFLIHFAPDSAVPSRMSDRFMAPMLATTTEHRLRWQAALTDPMPAPDAPGVEERPFPLRVADIDLLDHVNNAVYLSALEELLDRHADLIAGPHRVIVEYAKPLRAGEQVRLLGLRTGGTMDAWLAVGEQPRAVARVTKL GT:EXON 1|1-252:0| BL:SWS:NREP 1 BL:SWS:REP 11->252|Y2001_MYCTU|8e-45|39.4|236/250| SEG 102->111|iegsgggsie| BL:PDB:NREP 1 BL:PDB:REP 168->216|2fujA|5e-04|47.8|46/118| RP:PDB:NREP 1 RP:PDB:REP 17->232|3b7kC|3e-09|10.4|212/255| RP:PFM:NREP 1 RP:PFM:REP 17->222|PF01643|1e-10|27.7|191/229|Acyl-ACP_TE| HM:PFM:NREP 1 HM:PFM:REP 17->225|PF01643|3.2e-33|19.7|203/249|Acyl-ACP_TE| RP:SCP:NREP 2 RP:SCP:REP 17->90|2essA1|3e-08|17.6|74/145|d.38.1.8| RP:SCP:REP 159->250|2essA2|8e-08|14.1|92/98|d.38.1.8| HM:SCP:REP 12->144|2cyeA1|4.1e-16|22.9|131/0|d.38.1.1|1/2|Thioesterase/thiol ester dehydrase-isomerase| HM:SCP:REP 157->224|2essA2|2.3e-10|32.4|68/0|d.38.1.8|2/2|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 38 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- ---1----------11122-22112122222111112211----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 236 STR:RPRED 93.7 SQ:SECSTR ##############ccEEEEEEccGGGccccccccHHHHHHHHHHHHHHHHHHHHccTTccEEEEEEccEEccccccTTEEEEEEEEEEEEcccEEEEEEEEEEEETTTccEEEEEEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHccEEEEEEEcccGGGccTTccccHHHHHHHHHHHHHHHHHHHcccccEEEEccccccTTcEEEEEEEEccTTEEEEEEccccEEEEEEEE## PSIPRED ccccEEEEEEEccccEEEEEEEEEEEEEcccccEEHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEEEcccccccEEEEEEEEEEcccccEEEEEEEEcccccEEEEEEEEHHHccccccHHHccHHHHHHHHccccccccccccccccccccccccHHHHcccccEEEEEccccccccHHHHHHHHHHccHHHHHHccEEEEEEEEEcccccccEEEEEEEEcccEEEEEEEEccHHHHHHHHHcc //