[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56862.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:100 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   46->97 PF04341 * DUF485 2.4e-05 25.5 51/91  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56862.1 GT:GENE BAD56862.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2195448..2195750) GB:FROM 2195448 GB:TO 2195750 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56862.1 LENGTH 100 SQ:AASEQ MPILRPPVSPEQGRHPRRTRDCAEDAMLLEASPKRRAVRPAAGGARRGRVERGTAVLALIAAVAFAVGVGALSRSMTTGLFAGASISAGVPLALAMLPRP GT:EXON 1|1-100:0| TM:NTM 2 TM:REGION 52->74| TM:REGION 76->97| SEG 35->72|rravrpaaggarrgrvergtavlaliaavafavgvgal| HM:PFM:NREP 1 HM:PFM:REP 46->97|PF04341|2.4e-05|25.5|51/91|DUF485| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 7-19, 35-47| PSIPRED cccccccccccccccccHHHHHHHHHEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccccc //