[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56868.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  111/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.38.1
:364 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  178->243 2oauA1  b.38.1.3 * 2e-11 19.7 %
:HMM:SCOP  177->243 2oauA1 b.38.1.3 * 2.6e-16 40.3 %
:RPS:PFM   158->276 PF00924 * MS_channel 2e-13 35.3 %
:HMM:PFM   136->328 PF00924 * MS_channel 5.3e-31 26.9 193/207  
:BLT:SWISS 176->299 YJEP_ECOLI 2e-05 28.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56868.1 GT:GENE BAD56868.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2203739..2204833 GB:FROM 2203739 GB:TO 2204833 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:PROTEIN_ID BAD56868.1 LENGTH 364 SQ:AASEQ MEQVLRPLIVFAVTLAGTVTLGLLIDRLLCYGARRRPGTALPGLLRRVHLPLQVFLGAVALHGTYPLAELNLRQDAVIRNLLATTAIMAAAWLVVRGVDAAAENMLRAYADRTRDIAKVRQLRTQLGLVRRIVTFLLAVTTAAVVILLLVPSLRALGTSLLASAGVIGIIAGVAAQSTLSNLIAGLQIAFGDSVKIGDTVVVEGEWGTVEEITLAFLTVRIWDDRRLTMPVSYFNSKPYENWSRGGSQITGTVYLHLDHSTPIPLLREHLREYLRQRRDWDGRDCGLVVTDSTPTNIVVRATMTAADADDAWTLRCAVREELLGWLREHHPQALPKIPTAITTAGETAESDRRELVSATDGTRV GT:EXON 1|1-364:0| BL:SWS:NREP 1 BL:SWS:REP 176->299|YJEP_ECOLI|2e-05|28.4|116/1107| TM:NTM 3 TM:REGION 7->29| TM:REGION 132->154| TM:REGION 156->178| SEG 12->24|avtlagtvtlgll| SEG 132->150|ivtfllavttaavvilllv| SEG 164->175|agvigiiagvaa| SEG 199->211|tvvvegewgtvee| SEG 301->313|atmtaadaddawt| RP:PFM:NREP 1 RP:PFM:REP 158->276|PF00924|2e-13|35.3|119/203|MS_channel| HM:PFM:NREP 1 HM:PFM:REP 136->328|PF00924|5.3e-31|26.9|193/207|MS_channel| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF00924|IPR006685| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00924|IPR006685| RP:SCP:NREP 1 RP:SCP:REP 178->243|2oauA1|2e-11|19.7|66/67|b.38.1.3| HM:SCP:REP 177->243|2oauA1|2.6e-16|40.3|67/0|b.38.1.3|1/1|Sm-like ribonucleoproteins| OP:NHOMO 116 OP:NHOMOORG 112 OP:PATTERN -------------------------------------------------------------------- 1--1-----------------1--11-----111111----1111----1----1-----11--1--1111---------------------------------11111----------------111111111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1--------1--------1------------11-11-11--1----1-------------1-----------------1222----------------------------------1---1-----11111111111111-111111111-1-1------11---11-1--------------------11-----------------11----1-----12---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------11----------1----1---------------------------1111111111------------------------------------------------------------1-- --------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 339-364| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccEEEEEEEEEEEEEEEEcccccEEEEccHHHHcccEEEEEccccEEEEEEEEEEcccccHHHHHHHHHHHHHHcccccccEEEEEEEcccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEcccccccccccccccccccccc //