[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56869.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   35->55 PF03406 * Phage_fiber_2 0.00021 42.9 21/44  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56869.1 GT:GENE BAD56869.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2204908..2205312) GB:FROM 2204908 GB:TO 2205312 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56869.1 LENGTH 134 SQ:AASEQ MAGTVLAGCTDDNDTDTGNATETVTMVPTTTEGAQTTTESETEAVTPQAAQQLCDMIQPELDNWRGQGATVAKVSFNGTVQNWAARNDGLNDDVIRDRTIVDTVTTQTCPDVRQQALEVLEVPDLASALVGFGG GT:EXON 1|1-134:0| SEG 7->46|agctddndtdtgnatetvtmvptttegaqttteseteavt| HM:PFM:NREP 1 HM:PFM:REP 35->55|PF03406|0.00021|42.9|21/44|Phage_fiber_2| OP:NHOMO 6 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------3111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 27-45| PSIPRED ccEEEEEccccccccccccccccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEccEEccccccccccccHHHcccEEEEcccccccHHHHHHHHHHHccccHHHHHHcccc //