[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56871.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   56->159 3ba3B PDBj 4e-06 11.7 %
:RPS:SCOP  56->148 1flmA  b.45.1.1 * 6e-07 19.4 %
:HMM:SCOP  41->180 1flmA_ b.45.1.1 * 0.00016 24.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56871.1 GT:GENE BAD56871.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2206922..2207473) GB:FROM 2206922 GB:TO 2207473 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56871.1 LENGTH 183 SQ:AASEQ MTHTLGHPAATGAVPPTPPTPVPHPAAAHTVQRLPAVPDRPSEWHPGMLWWDASTVLVTRPDPAGHWPTTAHLVIPIDRGRLAFRVSSHSPEAQQLVRDPRVIVQAGNWRGKPAVGSRQHQGRAELIPAGPLFDKIDAGLRTKYGMRVGLARMLHNVAMGSTPYGDTAVVVTVHEVSPLPPSA GT:EXON 1|1-183:0| SEG 6->31|ghpaatgavpptpptpvphpaaahtv| RP:PDB:NREP 1 RP:PDB:REP 56->159|3ba3B|4e-06|11.7|103/142| RP:SCP:NREP 1 RP:SCP:REP 56->148|1flmA|6e-07|19.4|93/122|b.45.1.1| HM:SCP:REP 41->180|1flmA_|0.00016|24.3|115/122|b.45.1.1|1/1|FMN-binding split barrel| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 56.8 SQ:SECSTR #######################################################EEEEcGGGccEEEEEEccccTTcTTEEEEEEETTcTTHHHHTTccEEEEEEEEEcTTcccccEEEEEEEEEEEccccHHHHHHHHHHcTTHHHHHHHHGGGEEE######################## DISOP:02AL 1-6, 116-119, 181-183| PSIPRED cccccccccccccccccccccccccHHHHHHHHccccccccccccccEEEEcccEEEEEccccccccccEEEEEEEEcccEEEEEEcccccHHHHHHcccEEEEEccccccccccccccccccEEEEEccccHHHHcccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEccccccccc //