[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56873.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->139 1zkiA PDBj 4e-07 32.7 %
:RPS:PDB   31->153 3e1eD PDBj 5e-17 23.3 %
:RPS:SCOP  31->139 1zkiA1  d.38.1.5 * 1e-21 30.6 %
:HMM:SCOP  26->153 1zkiA1 d.38.1.5 * 1.6e-25 33.3 %
:HMM:PFM   67->143 PF03061 * 4HBT 1.4e-16 33.8 77/79  
:BLT:SWISS 23->155 Y1618_PSEAE 5e-08 30.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56873.1 GT:GENE BAD56873.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2209140..2209625 GB:FROM 2209140 GB:TO 2209625 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56873.1 LENGTH 161 SQ:AASEQ MTSTTTELPVLDYLRAVVAGTATPDQSCRFRYPTAISRTLGIRLVAVDHGTATVEIDADAAVHGNQQGTVHGGLLAELADAAIGTAHSTVVAPDESFTSIDLRAVYLRPVWRETLRAVARPVHSGRTITHYHCEVVRADGTPVALVTSVVTTLRGERAAGR GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 23->155|Y1618_PSEAE|5e-08|30.3|132/145| BL:PDB:NREP 1 BL:PDB:REP 34->139|1zkiA|4e-07|32.7|101/120| RP:PDB:NREP 1 RP:PDB:REP 31->153|3e1eD|5e-17|23.3|120/137| HM:PFM:NREP 1 HM:PFM:REP 67->143|PF03061|1.4e-16|33.8|77/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 31->139|1zkiA1|1e-21|30.6|108/126|d.38.1.5| HM:SCP:REP 26->153|1zkiA1|1.6e-25|33.3|126/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 33 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- --------------2------------------1-11------1-------------------------1------------1-------------------1--------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------1-----------------------1---------------1----------------------------------------------2-------------1-----------1------------22-11--1---------------------------------------1---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 85.1 SQ:SECSTR ########################HHHccHTcHTcHHHHHTcEEEEEETTEEEEEEEccGGEGccTTccccHHHHHHHHHHHHHHHHHTTccTTEEEEEEEEEEEEcccccccEEEEEEEEEEccccEEEEEEEEEEEccccEEEEEEEEEEEEHHHEcTE DISOP:02AL 1-6, 158-161| PSIPRED cccccccccccHHHHHHHcccccccHHHHHccccccHHHcccEEEEEcccEEEEEEEEcHHHHcccccEEHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEccccccEEEEEEEEEEcccEEEEEEEEEEEccccEEEEEEEEEEEEEccccccc //