[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56874.1
DDBJ      :             putative transcription antitermination regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.1d.110.3d.243.1
:220 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   56->215 3btaA PDBj 3e-13 10.2 %
:RPS:SCOP  33->124 1tfoA1  d.243.1.1 * 8e-10 9.2 %
:HMM:SCOP  15->124 1bywA_ d.110.3.6 * 2.4e-13 30.0 %
:HMM:SCOP  135->188 1qo0D_ c.23.1.3 * 1.6e-07 31.5 %
:RPS:PFM   40->112 PF08447 * PAS_3 1e-06 41.1 %
:RPS:PFM   135->188 PF03861 * ANTAR 4e-07 38.9 %
:HMM:PFM   139->188 PF03861 * ANTAR 2.7e-20 38.0 50/56  
:HMM:PFM   31->116 PF08447 * PAS_3 4e-13 30.2 86/91  
:BLT:SWISS 51->171 Y1796_MYCLE 2e-17 33.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56874.1 GT:GENE BAD56874.1 GT:PRODUCT putative transcription antitermination regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2209775..2210437 GB:FROM 2209775 GB:TO 2210437 GB:DIRECTION + GB:PRODUCT putative transcription antitermination regulator GB:PROTEIN_ID BAD56874.1 LENGTH 220 SQ:AASEQ MSEGNGTPPVSAADAWRPAGSYRFWFSDQRWEWSDEVAVLHGYAPGSVVPTTELMLAHKHPEDRDAVADILAAAVSTGQPFCSRHRILDTRGRVRHVLVVGDEMRDADGRVVGSTGYYIDLTDRLDEARKEVLDETLPDLVATRSVIDQAKGALMLMYGISAEQAFRVLAWRSQETNTKLRDLAARLVEAVTEFGGCGVGERTRFDHLLLTAHERDTPEP GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 51->171|Y1796_MYCLE|2e-17|33.9|121/137| RP:PDB:NREP 1 RP:PDB:REP 56->215|3btaA|3e-13|10.2|147/1277| RP:PFM:NREP 2 RP:PFM:REP 40->112|PF08447|1e-06|41.1|73/90|PAS_3| RP:PFM:REP 135->188|PF03861|4e-07|38.9|54/56|ANTAR| HM:PFM:NREP 2 HM:PFM:REP 139->188|PF03861|2.7e-20|38.0|50/56|ANTAR| HM:PFM:REP 31->116|PF08447|4e-13|30.2|86/91|PAS_3| RP:SCP:NREP 1 RP:SCP:REP 33->124|1tfoA1|8e-10|9.2|87/103|d.243.1.1| HM:SCP:REP 15->124|1bywA_|2.4e-13|30.0|110/0|d.110.3.6|1/1|PYP-like sensor domain (PAS domain)| HM:SCP:REP 135->188|1qo0D_|1.6e-07|31.5|54/0|c.23.1.3|1/1|CheY-like| OP:NHOMO 64 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- --------------233----31121-----113335151-------------22---------2--------------------------------------------------------------------2---------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------11--11------------------1---1-------------------------------------------------------------------------------------------------------------------------------1--------1----------------------------------------------------------1----------------1------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 196 STR:RPRED 89.1 SQ:SECSTR #################cccccEEEcTTccEEEcTHHHHHHcccHHHHHHcGGGGccTTccHHccccHcEEEEEcccccccccEEEEEEETEEEEEEcccccGGGccccccccccccccccccTccHHHHHHTcHHHHHHHHHHcHHHHccccccTTGEEEEEcTTccEEEEccEEEEEccccTTccHHHEEEccccccccTTTccccccE##EE##### DISOP:02AL 1-5, 216-220| PSIPRED cccccHHHHHHHHHHHHcccEEEEEEcccEEEEcHHHHHHHcccHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEEEEcccccEEEEEEEEEEEEcccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccc //