[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56876.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
b.47.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   109->213 1p3cA PDBj 1e-04 31.0 %
:RPS:SCOP  96->280 1p3cA  b.47.1.1 * 3e-11 21.3 %
:HMM:SCOP  63->271 1qtfA_ b.47.1.1 * 1.9e-19 20.9 %
:HMM:PFM   100->277 PF00089 * Trypsin 1.2e-07 22.9 170/219  
:BLT:SWISS 113->191 MPR_BACSU 5e-06 39.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56876.1 GT:GENE BAD56876.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2211813..2212724 GB:FROM 2211813 GB:TO 2212724 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56876.1 LENGTH 303 SQ:AASEQ MPSEEHTMTVIDPAPGHLLERTEIPTTVKELVHAIPGQEQHALNPAEAPARGDAVTAPYCPPWATYAEPTVAETFSLDGQTFYEPLVHEEPNPMLYPMCTVGIVFNSNGKRGSGVLVGPNLLLTAGHVAPWGASNWSMEFIPAFRNGDRPFGSSFVQSYWGYNPGGDVPTGYDYVICKLYNPLGNALGWMGSQSWGDEDEYYNRRYVSSGYPGSYGQRPAVELDMGIRDIDNDSPGKELEFALRADLGPGWSGGPLWVHTANPFVVGVCSGQEKDGLDPTRLVFAGGKGMVDVVRHGLTDMRP GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 113->191|MPR_BACSU|5e-06|39.0|77/313| BL:PDB:NREP 1 BL:PDB:REP 109->213|1p3cA|1e-04|31.0|100/215| HM:PFM:NREP 1 HM:PFM:REP 100->277|PF00089|1.2e-07|22.9|170/219|Trypsin| RP:SCP:NREP 1 RP:SCP:REP 96->280|1p3cA|3e-11|21.3|174/215|b.47.1.1| HM:SCP:REP 63->271|1qtfA_|1.9e-19|20.9|196/0|b.47.1.1|1/1|Trypsin-like serine proteases| OP:NHOMO 22 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------111-111111111111111------1-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 120 STR:RPRED 39.6 SQ:SECSTR ########################################################################################cTTGGGcTTGGGEEEEEETTccEEEEEEEETTEEEEcHHHEETTTTEEcccEEETccTTccTTccEEEEEE##EccHHHHHHcGccEEEEEcccHHHHHcc###cccccccccTTcEEEEEEccH########################################################################################## DISOP:02AL 1-5, 302-303| PSIPRED ccccccEEEEEcccccccEEcccccHHHHHHHHHccccHHHccccccccccccEEEccccccccccccccHHEEEEcccHHHHHHHHccccccEEccHHEEEEEEEccccEEEEEEEccEEEEEEEEEEcccccccEEEEEEEccccccccccEEEEEEEEEEccccccccccEEEEEEcccHHHHHHHEEEEEEccHHHcccccEEEEccccccccccHHHHHHHHEEcccccccccccccEEccccccccccEEEEEEccEEEEEEEccccccccccEEEEEcccccEEEEEEEcEEEccc //