[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56878.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->118 1nkiA PDBj 1e-08 36.1 %
:RPS:PDB   3->146 3e0rA PDBj 7e-17 14.6 %
:RPS:SCOP  2->154 1zswA2  d.32.1.10 * 2e-17 26.4 %
:HMM:SCOP  2->165 1zswA2 d.32.1.10 * 6.4e-30 35.8 %
:RPS:PFM   4->114 PF00903 * Glyoxalase 1e-05 34.9 %
:HMM:PFM   3->119 PF00903 * Glyoxalase 4.1e-19 32.5 117/128  
:BLT:SWISS 1->118 FOSA_PSEAE 3e-08 36.1 %
:PROS 99->118|PS00082|EXTRADIOL_DIOXYGENAS
:PROS 6->27|PS00934|GLYOXALASE_I_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56878.1 GT:GENE BAD56878.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2213744..2214280 GB:FROM 2213744 GB:TO 2214280 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56878.1 LENGTH 178 SQ:AASEQ MRGINHVVLFVADLPRSLAFYEDVLGFQRLPGGFPGGAFLRHAGSANDHDLGLFQSRDRTPVTPGAVGLYHVAWEVDTLAELATMRDRLRAAGALTGTGDHGSTKALYGRDPDGIEFEVCWLVPDEHVEEALTPGTALTAPLDLDAVIERYGAETPGGPRTDHAVWARLAARTAETNR GT:EXON 1|1-178:0| BL:SWS:NREP 1 BL:SWS:REP 1->118|FOSA_PSEAE|3e-08|36.1|108/135| PROS 99->118|PS00082|EXTRADIOL_DIOXYGENAS|PDOC00078| PROS 6->27|PS00934|GLYOXALASE_I_1|PDOC00720| BL:PDB:NREP 1 BL:PDB:REP 1->118|1nkiA|1e-08|36.1|108/134| RP:PDB:NREP 1 RP:PDB:REP 3->146|3e0rA|7e-17|14.6|130/235| RP:PFM:NREP 1 RP:PFM:REP 4->114|PF00903|1e-05|34.9|106/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 3->119|PF00903|4.1e-19|32.5|117/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 2->154|1zswA2|2e-17|26.4|148/170|d.32.1.10| HM:SCP:REP 2->165|1zswA2|6.4e-30|35.8|159/0|d.32.1.10|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 37 OP:NHOMOORG 37 OP:PATTERN 11------------------------------------------------------------------ ----1----------------------------1111---1111------------------1-------------------1--------------------1---1-------------------------------------------------------------------------------------1-----------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------1----------1--1-1---1-------------11-1111-----------------------1-1-11--1-----------------------------------------------------------------------------------------------------------1---------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 146 STR:RPRED 82.0 SQ:SECSTR TTEEEEEEEEEccHHHHHHHHTTTTcEEEEEcccEEEEEcTTETTEccEEEEEEEccTTcccccccccEEEEEEEEccHHHHHTccHHHTTcccccEEEEccccEEEEEEcTTccEEEEEEccEETEccccGGGcEEccccccccc################################ DISOP:02AL 172-178| PSIPRED cccEEEEEEEEccHHHHHHHHHHHHccEEEcccccccEEEEEEcccccEEEEEEccccccccccccccEEEEEEEEccHHHHHHHHHHHHHccccccccccccEEEEEEEcccccEEEEEEEccccccccccccccccccccccHHHHHHccccccccccccHHHHHccccccccccc //