[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56879.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.34.1
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   13->187 1e20A PDBj 9e-15 23.1 %
:RPS:SCOP  30->166 1p3y1  c.34.1.1 * 3e-20 13.4 %
:HMM:SCOP  5->185 1g5qA_ c.34.1.1 * 5e-24 27.7 %
:RPS:PFM   13->99 PF02441 * Flavoprotein 1e-07 39.1 %
:HMM:PFM   12->119 PF02441 * Flavoprotein 3.4e-19 29.0 107/122  
:BLT:SWISS 35->147 HAL3B_ARATH 5e-04 32.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56879.1 GT:GENE BAD56879.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2214318..2214884 GB:FROM 2214318 GB:TO 2214884 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56879.1 LENGTH 188 SQ:AASEQ MNSLGQPVLYALVTGSPAARDVGRLVDSAQRDGWDVCVVASPQGRRFLDTAALAEQTGHVVRTEYKDPGTPDLLPPADAMIAAPLTCNSVAKFAVGISDTLPLGLLVEGVGKGLPIVAVPFSNRAQMSFPPIRAALRNLAEWGVTLIGDAVHGGHEPGTGEQRLAEFPWAQAWQAVLDHPRWKGAGQG GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 35->147|HAL3B_ARATH|5e-04|32.1|112/201| SEG 101->115|lplgllvegvgkglp| RP:PDB:NREP 1 RP:PDB:REP 13->187|1e20A|9e-15|23.1|169/185| RP:PFM:NREP 1 RP:PFM:REP 13->99|PF02441|1e-07|39.1|87/122|Flavoprotein| HM:PFM:NREP 1 HM:PFM:REP 12->119|PF02441|3.4e-19|29.0|107/122|Flavoprotein| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF02441|IPR003382| RP:SCP:NREP 1 RP:SCP:REP 30->166|1p3y1|3e-20|13.4|134/171|c.34.1.1| HM:SCP:REP 5->185|1g5qA_|5e-24|27.7|173/174|c.34.1.1|1/1|Homo-oligomeric flavin-containing Cys decarboxylases, HFCD| OP:NHOMO 18 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ----2-------------------------------1----221----------------23----11111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 171 STR:RPRED 91.0 SQ:SECSTR ############EcccGGGGGHHHHHHHHHHTTcEEEEEEcTTHHHHccGGGccTTcEEEcTTHHHHHcccTTcccHcEEEEEEEcHHHHHHHHTTccccHHHHHHHTccTTccEEEEEEcccHHHHHcHHHHHHHHHHHHHTcEEccccTTcTTccccccccccc##HHHHHHHHH##HHHHHTTc# DISOP:02AL 1-4, 184-188| PSIPRED cccccccEEEEEEEcHHHHHHHHHHHHHHHHcccEEEEEEcHHHHHHccHHHHHHHHcccHHHHHcccccccccccccEEEEEcccHHHHHHHHHHHcccHHHHHHHHHHHccccEEEEEcccHHHHccHHHHHHHHHHHHccEEEEccccccccccccccccccccHHHHHHHHHHccccccccccc //