[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56881.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56881.1 GT:GENE BAD56881.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2215963..2216256 GB:FROM 2215963 GB:TO 2216256 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56881.1 LENGTH 97 SQ:AASEQ MFAFGWIDPLSPTYEWDSGQVRRLARRLGYPVRWGDPCSVLGVAEQVAASGADVVLLPSSAHIDAVSLNRVLAVADVECAAPRVSFARWSRFGGVRR GT:EXON 1|1-97:0| OP:NHOMO 6 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------6-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 94-97| PSIPRED cccccccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHccccEEEEccHHHHccccHHHHHHHHHHHHHcccccHHHHHHcccccc //