[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56886.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.6e.29.1
:335 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   253->295 1x3uA PDBj 1e-05 44.2 %
:RPS:PDB   41->164 3e0yB PDBj 4e-06 15.8 %
:RPS:PDB   214->297 3cloA PDBj 9e-10 28.0 %
:RPS:SCOP  22->119 1i6vC  e.29.1.1 * 3e-04 25.0 %
:RPS:SCOP  252->297 1fseA  a.4.6.2 * 6e-09 39.1 %
:HMM:SCOP  231->313 1p4wA_ a.4.6.2 * 5.3e-15 31.3 %
:RPS:PFM   253->297 PF00196 * GerE 2e-04 44.4 %
:HMM:PFM   252->306 PF00196 * GerE 1.9e-16 40.0 55/58  
:BLT:SWISS 253->297 UHPA_SHIFL 6e-06 46.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56886.1 GT:GENE BAD56886.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2220416..2221423) GB:FROM 2220416 GB:TO 2221423 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56886.1 LENGTH 335 SQ:AASEQ MRNPAVDSGGGRLAKAVGLLQRHMLFDAALLVHQPAGARSRIVSRLGYSQGAAWALQHLFPRDYEVGFTARLNPDDHLPLSISDVRVDIREQFTRTVLFRRYLRAEGYADGMSVELFDDGDYVGVAHFSARRPDAFGTAQRALAQDLSGLLALALRHGEHAAESPAERGAAGRTYLRWGPDQRIADTARAVPFLDDPAFARVVDAFLTSALTELRHLWLHQGAWYRVVLARRGDFGDLEVCVRAVTPDEVWRLSAQELRVLSGLVVGRTDAEIAADLSLSPRTVHAHMVSIRRKLGVTRRTEAAARATATATFVPGPATAPVPDLARIYRDTALS GT:EXON 1|1-335:0| BL:SWS:NREP 1 BL:SWS:REP 253->297|UHPA_SHIFL|6e-06|46.7|45/196| SEG 298->312|trrteaaaratatat| BL:PDB:NREP 1 BL:PDB:REP 253->295|1x3uA|1e-05|44.2|43/79| RP:PDB:NREP 2 RP:PDB:REP 41->164|3e0yB|4e-06|15.8|120/150| RP:PDB:REP 214->297|3cloA|9e-10|28.0|82/249| RP:PFM:NREP 1 RP:PFM:REP 253->297|PF00196|2e-04|44.4|45/57|GerE| HM:PFM:NREP 1 HM:PFM:REP 252->306|PF00196|1.9e-16|40.0|55/58|GerE| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 22->119|1i6vC|3e-04|25.0|92/1113|e.29.1.1| RP:SCP:REP 252->297|1fseA|6e-09|39.1|46/67|a.4.6.2| HM:SCP:REP 231->313|1p4wA_|5.3e-15|31.3|83/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 236 STR:RPRED 70.4 SQ:SECSTR ############HHHHHHHHHHTTTcccEEEEEEEccTTcHHHHHHHHHTTccEEEEEEEETTEEEEEEEEcccGGGcEEETTTcEEETTTcHHHHHHcEEEEEcccccEEEEEEEEccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHTTc#################################################EEEEccccccccccccEEEETTTEEEEcccHHHHTTTTcccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTc###################################### DISOP:02AL 1-8, 333-335| PSIPRED ccccccccccHHHHHHHHHHHHHcccccEEEccccccccccEEEEccccccHHHHHHHHcccccHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccHHHHccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccHHHHHHHHccccc //