[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56889.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:132 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   8->129 1cjxA PDBj 4e-08 9.0 %
:RPS:SCOP  1->125 1xy7A  d.32.1.9 * 3e-18 25.4 %
:HMM:SCOP  1->128 1u69A_ d.32.1.7 * 1.2e-19 35.5 %
:HMM:PFM   10->124 PF00903 * Glyoxalase 2.4e-06 18.3 115/128  
:BLT:SWISS 3->122 Y911_MYCBO 1e-08 34.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56889.1 GT:GENE BAD56889.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2222849..2223247) GB:FROM 2222849 GB:TO 2223247 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56889.1 LENGTH 132 SQ:AASEQ MTSITPYVMVDRAHDYRAFLEHALDAEVSTVVALPTDESRVVHAEARIGDSVLFFADSGAEGQRCLSSPTEPVHVQLWATVPDADTVFARAVEAGARPAQEITAQPDGSRMGGFVDPFGTLWWISTTAPAAV GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 3->122|Y911_MYCBO|1e-08|34.8|115/170| RP:PDB:NREP 1 RP:PDB:REP 8->129|1cjxA|4e-08|9.0|122/352| HM:PFM:NREP 1 HM:PFM:REP 10->124|PF00903|2.4e-06|18.3|115/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->125|1xy7A|3e-18|25.4|114/120|d.32.1.9| HM:SCP:REP 1->128|1u69A_|1.2e-19|35.5|110/0|d.32.1.7|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 67 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- 111-----------1------------------11111---1---2-----------------------------------------------------------1-2-----------------------------11---------------------------1------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------1------------------------------------------11-11-111---1-111---1-1------111------------1-----------------------------------1-1-1-1--1111----------------------------------------1--1111------------------------------------------------------------------------------------------------------------------11111----1-1---------------------------------111--1111----------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 93.9 SQ:SECSTR #######ccTTHHHHHHHHHHHHHccEEEEEEEEEccccEEEEEEEEcTTcccEEEEEEEcTHHHHHHHTcccccEEEEEEccHHHHHHHHHHTTccccccccHHHHHTHHHHcTTccccHHHHHHHTcTc# DISOP:02AL 132-133| PSIPRED ccEEEEEEEEccHHHHHHHHHHHHccEEEEEEEcccccccEEEEEEEEccEEEEEEccccccccccccccccEEEEEEEEEccHHHHHHHHHHcccEEEEcHHHcccccEEEEEEcccccEEEEEccccccc //