[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56890.1
DDBJ      :             putative transporter
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  489/915 : Eukaryota  38/199 : Viruses  1/175   --->[See Alignment]
f.38.1
:470 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   27->222 2d33D PDBj 3e-07 7.1 %
:RPS:SCOP  2->405 1pw4A  f.38.1.1 * 5e-13 13.8 %
:HMM:SCOP  1->433 1pw4A_ f.38.1.1 * 2.7e-57 26.2 %
:RPS:PFM   27->220 PF00083 * Sugar_tr 1e-15 39.7 %
:HMM:PFM   30->239 PF00083 * Sugar_tr 3.8e-21 22.0 200/451  
:HMM:PFM   276->425 PF07690 * MFS_1 3e-12 22.9 144/353  
:BLT:SWISS 20->431 YHJE_ECOLI 2e-53 30.7 %
:PROS 132->157|PS00217|SUGAR_TRANSPORT_2
:TM
:REPEAT 2|56->231|276->443
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56890.1 GT:GENE BAD56890.1 GT:PRODUCT putative transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2223649..2225061) GB:FROM 2223649 GB:TO 2225061 GB:DIRECTION - GB:PRODUCT putative transporter GB:PROTEIN_ID BAD56890.1 LENGTH 470 SQ:AASEQ MTAVNSPQLAPAETRERPMKLAIASGVGTILEFYDFAIYGTATALVFNKVYFDTDDPWFGTFLGFATFAIGFVMAPVGAVIFGHYGDRFGRRAALTTAFILMGSATLVMGLVPDSRSIGIVAPMILIFLRMLHGISRGGEIGGAVLLAAEHAPASRRGLYGCFVTLGSPVGAILANTAFALVLLLPMDQVIAWGWRIPFLVGGVVLIIGIWTRMRISETPDFAGARSGADRPAPRGLAVLRQDWRGVLRAAGVNIGQNCYAFLLFTFMLSFLTEPDPGRGFSRSAVVWGITAALACHAATVVLGSHLSDRLGRKTVIGFGMTSAAVFAPVLFWVTAHGSFLACIAVICIGFTLTGFVYGPMFTMFAEQFPVTQRYSGVGIGYQVGAVVGGGIAPMVANRIVSGTGSVIPVGFYAAALMLISLFALMKGKETAPLAVGRSVRSRFGAAAGSTDRAARAGFPADAKPVEQSS GT:EXON 1|1-470:0| BL:SWS:NREP 1 BL:SWS:REP 20->431|YHJE_ECOLI|2e-53|30.7|411/440| PROS 132->157|PS00217|SUGAR_TRANSPORT_2|PDOC00190| TM:NTM 12 TM:REGION 24->46| TM:REGION 61->83| TM:REGION 93->115| TM:REGION 117->139| TM:REGION 163->185| TM:REGION 192->213| TM:REGION 256->278| TM:REGION 283->305| TM:REGION 315->337| TM:REGION 340->362| TM:REGION 377->399| TM:REGION 403->425| NREPEAT 1 REPEAT 2|56->231|276->443| SEG 262->273|fllftfmlsflt| SEG 445->458|gaaagstdraarag| RP:PDB:NREP 1 RP:PDB:REP 27->222|2d33D|3e-07|7.1|182/499| RP:PFM:NREP 1 RP:PFM:REP 27->220|PF00083|1e-15|39.7|174/433|Sugar_tr| HM:PFM:NREP 2 HM:PFM:REP 30->239|PF00083|3.8e-21|22.0|200/451|Sugar_tr| HM:PFM:REP 276->425|PF07690|3e-12|22.9|144/353|MFS_1| GO:PFM:NREP 4 GO:PFM GO:0005215|"GO:transporter activity"|PF00083|IPR005828| GO:PFM GO:0006810|"GO:transport"|PF00083|IPR005828| GO:PFM GO:0016021|"GO:integral to membrane"|PF00083|IPR005828| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00083|IPR005828| RP:SCP:NREP 1 RP:SCP:REP 2->405|1pw4A|5e-13|13.8|385/434|f.38.1.1| HM:SCP:REP 1->433|1pw4A_|2.7e-57|26.2|405/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 2923 OP:NHOMOORG 548 OP:PATTERN ------3957996585-623332--------------------------------------1151--- 112-131699D-4154433-37--2U3333325999DNnp--224-1-1451PJL726-----428Q77312222222-13-A-1112--------1--1-2---2-2-2-----------------1-1---1-------11112--------------131---------1-----1-----1--------1222222211222222------222-231-1-------1-1111111111111111-112----22-3-----11-1---22-----------------------------------------------------------------11-------------------------------1--44461442452F551-32323255555554547-66A55I7C231-666622444545B4-----6-----1-32333333455122-144333444112267AB86G5676673233-1564-73345XPPWRTCFHHDWWdOLMLJCIYJcAIDA-5GC932622711-8336---1141-------11--1-1--1----21--------1-----111111-----1-5455341-2222212-------1-1---------------1--------------1---------88782875779688866-776678666778666566788766--29989899998889898944754552-433333333333--1-11111575711-11-------22211--19999A691125-99B8BFD91EFFF-B9A955449555----------1----55545444441111---------------------------------------------------------1- ------------1111-11-1-1---1----1111-11111---11------1-------1----------------------------------2-------122--6------------------------------------------------------3------------11-----1--1-21--241---1 --------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- STR:NPRED 182 STR:RPRED 38.7 SQ:SECSTR ##########################HHHHHHHHHHHHHHHTTHHHHHHccccEEEGGGcccccEEcTTcEEEcTTcccGGGcTTcccccTTccccccHHHHHHHHHHHHHccc########HHHHTTccEETTEEccccccccccGGGccccEEEEccccTTccHHHHHHHHcccEEEEEEEE######ccTTcTTcccHHHHHHHHHHHHHHHHcccccc######################################################################################################################################################################################################################################################## DISOP:02AL 1-17, 222-235, 435-470| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHccccccccccccc //