[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56894.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.102.3c.55.1
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   49->94 2bjvA PDBj 3e-05 21.7 %
:RPS:SCOP  37->69 1u6zA3  c.55.1.8 * 2e-04 18.2 %
:RPS:SCOP  48->106 1hn0A1  a.102.3.2 * 8e-06 10.2 %
:BLT:SWISS 6->121 CEF1_CANAL 9e-05 28.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56894.1 GT:GENE BAD56894.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2228422..2228871) GB:FROM 2228422 GB:TO 2228871 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56894.1 LENGTH 149 SQ:AASEQ MVARHVRPARSVRVFRLTRDIDADDLSADLETEKPPRRTSASFSPTCVRLSPAAHRQLTKLPWPGNVAQLRRVLSDTLSRQRFGTITPDVLPPECHALTRRPPPSDDPLRVDARSTHRFGRPAAHTPADQADRAPVHTRCPDLDSPRRG GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 6->121|CEF1_CANAL|9e-05|28.2|103/610| RP:PDB:NREP 1 RP:PDB:REP 49->94|2bjvA|3e-05|21.7|46/236| RP:SCP:NREP 2 RP:SCP:REP 37->69|1u6zA3|2e-04|18.2|33/177|c.55.1.8| RP:SCP:REP 48->106|1hn0A1|8e-06|10.2|59/384|a.102.3.2| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------1----------1-2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 69.8 SQ:SECSTR EEEEEEccGGGccGGGTcTTTccEEEEcccccHHHHHHHHHHHTTccccccHHHHHHHHHcccTTHHHHHHHHHHHHHHHHccccccccccccccHHHHHTTcc############################################# DISOP:02AL 1-7, 144-149| PSIPRED cccccccccccEEEEEEEccccccccHHHHcccccHHHHHHHHccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHcccccccccEEEccHHHHcccccccccccccccccccccccccccccccc //