[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56895.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.3
:116 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  14->107 1wa8B1 a.25.3.1 * 9.6e-16 28.7 %
:HMM:PFM   18->99 PF06013 * WXG100 4.8e-16 32.9 82/86  
:BLT:SWISS 18->84 ES6LD_MYCTU 4e-06 29.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56895.1 GT:GENE BAD56895.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2228986..2229336 GB:FROM 2228986 GB:TO 2229336 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56895.1 LENGTH 116 SQ:AASEQ MGGRVAGETDTYGTVFAIVPGEVTDAGVYIQQVAESLINGLGTLDREVATVLGNWKGAAAEAFGDGWTETRKGAADVLNALAAMGELLGVASKALVSQDALNSGTLGSLDLPQLDM GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 18->84|ES6LD_MYCTU|4e-06|29.9|67/100| HM:PFM:NREP 1 HM:PFM:REP 18->99|PF06013|4.8e-16|32.9|82/86|WXG100| HM:SCP:REP 14->107|1wa8B1|9.6e-16|28.7|94/0|a.25.3.1|1/1|EsxAB dimer-like| OP:NHOMO 6 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------1-14-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccccccccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccccc //