[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56896.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:235 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56896.1 GT:GENE BAD56896.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2229644..2230351 GB:FROM 2229644 GB:TO 2230351 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56896.1 LENGTH 235 SQ:AASEQ MAAVSPQSYDSAATACYDLSEKFQTVYETPQTVLLETNAMVGGYEAVKTWSKAYDDRAAALTMVATNFARALQRLGDVLTASSYNWKSSEYTANRNSNKGNPPSLPGGIPSELPYGAGAVIGIASSGGYSNGLQTDWTELQDKVTTLVTGGQVPDGDTDKLARAASMWKTFANSDPLEYGVAQLLAVASGLEQGFGAEVPRDIPNHAANLRKLAHKLREIRSADTTSPTQSKPTT GT:EXON 1|1-235:0| SEG 115->130|ygagavigiassggys| OP:NHOMO 5 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------4-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 98-102, 104-107, 225-235| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHccccccccccccc //