[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56898.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->120 HAT1_YEAST 5e-05 26.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56898.1 GT:GENE BAD56898.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2231083..2231457 GB:FROM 2231083 GB:TO 2231457 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56898.1 LENGTH 124 SQ:AASEQ MTTVDSDDRPNARRKRRQFTPEQKAGFAKIGNDSAKLLERFADRLRPEVLAQCRTYSEVGEWTLLIDNLCASLVKDKILISSAERDALADLLPMFGDPEQNAYLVYIDSYDRVLEALNVSSELT GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 1->120|HAT1_YEAST|5e-05|26.1|115/100| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-24, 122-124| PSIPRED cccccccccccHHHHHHccccHHHcccHHccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHccc //