[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56900.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->85 3bguB PDBj 1e-06 27.4 %
:RPS:PDB   1->91 3bguB PDBj 7e-18 26.4 %
:RPS:SCOP  1->87 1iujA  d.58.4.5 * 6e-06 18.6 %
:HMM:SCOP  1->104 1rjjA_ d.58.4.4 * 1.6e-20 31.7 %
:RPS:PFM   2->90 PF07876 * Dabb 1e-07 34.9 %
:HMM:PFM   2->92 PF07876 * Dabb 9.2e-15 26.4 91/97  
:BLT:SWISS 2->90 POP3_ARATH 3e-04 28.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56900.1 GT:GENE BAD56900.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2233005..2233421) GB:FROM 2233005 GB:TO 2233421 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56900.1 LENGTH 138 SQ:AASEQ MIYHVTRLTVRPDAPADKVEEALESMRNQGRVIPSVISFIVGPDIGGEYQWGATYVIEDLDGYWEYLKHPAHRHTDEIGLPLVDKFVSFDVTDDEDPEIATKIAALHQRRYQEDPALAQLVSDLASYSGSSAPGPRGN GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 2->90|POP3_ARATH|3e-04|28.1|89/100| BL:PDB:NREP 1 BL:PDB:REP 2->85|3bguB|1e-06|27.4|84/102| RP:PDB:NREP 1 RP:PDB:REP 1->91|3bguB|7e-18|26.4|91/102| RP:PFM:NREP 1 RP:PFM:REP 2->90|PF07876|1e-07|34.9|86/97|Dabb| HM:PFM:NREP 1 HM:PFM:REP 2->92|PF07876|9.2e-15|26.4|91/97|Dabb| RP:SCP:NREP 1 RP:SCP:REP 1->87|1iujA|6e-06|18.6|86/102|d.58.4.5| HM:SCP:REP 1->104|1rjjA_|1.6e-20|31.7|101/0|d.58.4.4|1/1|Dimeric alpha+beta barrel| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-----1---------------------1--11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 68.8 SQ:SECSTR EEEEEEEEEEcTTccHHHHHHHHHHHHTHHHHcTTccEEEEEEcccccccEEEEEEEEHHHHHHHHHHcHHHHHHHHHHGGEEEEEEEEEcEEEE########################################### DISOP:02AL 129-138| PSIPRED ccEEEEEEEEcccccHHHHHHHHHHHHHccHHHHHHHHHHccccccccccEEEEEEEccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccccc //