[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56901.1
DDBJ      :             putative transporter
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:396 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  138->314 1pv6A  f.38.1.2 * 7e-06 13.6 %
:HMM:SCOP  1->396 1pw4A_ f.38.1.1 * 4.7e-62 29.6 %
:RPS:PFM   35->328 PF07690 * MFS_1 7e-07 27.5 %
:HMM:PFM   20->319 PF07690 * MFS_1 4.4e-40 32.1 296/353  
:BLT:SWISS 231->359 MDTD_YERE8 4e-06 25.6 %
:PROS 72->88|PS00216|SUGAR_TRANSPORT_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56901.1 GT:GENE BAD56901.1 GT:PRODUCT putative transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2233418..2234608) GB:FROM 2233418 GB:TO 2234608 GB:DIRECTION - GB:PRODUCT putative transporter GB:PROTEIN_ID BAD56901.1 LENGTH 396 SQ:AASEQ MPDGTGLRPAPTRTAQATVLAAATLTIMAAAIIAPSLPAMADAYADTPGAETLVQLALTVTSLAIAVGAPAAGMAADRLGRRPVLLTGLVLYAAAGTASLYVTDLSLLLATRALLGIAVAAIMTAITTLIADWFTGPRRARMLGLQQAFASIGGVVFLPLAGVLAGLDYRAPAWIYALSLAVVPFALSAVPEPIRRDTDPARRAGFRVPGRVLVVYALALTLTLVFFLAPTQLPFLLPDFGAGPAVTGAVIAVSTLTGAVGAFAYAAVRRRVGSTTITCASVALLATGWLVIGTAGTLWAVVAGLLIGGTGVGLAVPNLNLILTELTPPDARARALSGLVTAIFLGQFASPLIAAPLIEVSGIAGTFTWTAIACLACLAAATSLLVRTPHRKEEDR GT:EXON 1|1-396:0| BL:SWS:NREP 1 BL:SWS:REP 231->359|MDTD_YERE8|4e-06|25.6|129/469| PROS 72->88|PS00216|SUGAR_TRANSPORT_1|PDOC00190| TM:NTM 11 TM:REGION 18->40| TM:REGION 53->75| TM:REGION 86->108| TM:REGION 115->137| TM:REGION 160->182| TM:REGION 211->233| TM:REGION 245->267| TM:REGION 272->294| TM:REGION 303->325| TM:REGION 335->357| TM:REGION 366->388| SEG 12->34|trtaqatvlaaatltimaaaiia| SEG 64->76|aiavgapaagmaa| SEG 105->131|lslllatrallgiavaaimtaittlia| SEG 212->229|vlvvyalaltltlvffla| SEG 370->385|taiaclaclaaatsll| RP:PFM:NREP 1 RP:PFM:REP 35->328|PF07690|7e-07|27.5|291/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 20->319|PF07690|4.4e-40|32.1|296/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 138->314|1pv6A|7e-06|13.6|177/417|f.38.1.2| HM:SCP:REP 1->396|1pw4A_|4.7e-62|29.6|395/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 28 OP:NHOMOORG 24 OP:PATTERN ---------------------------------------------1---------------------- ------------------------------------1-------------------------------------------------------------------1-------------------------1------------------1----------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------------21-------112111-------------------------------------------------------------------1--1---------------------------------2-------------------1--1-------------------------------------------------------------------------1------------------------------------------------------------2----------------------------------1---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 192-209, 329-332, 386-396| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //