[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56906.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:176 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   135->159 PF02796 * HTH_7 0.00013 28.0 25/45  
:HMM:PFM   81->112 PF01527 * Transposase_8 0.00063 31.2 32/76  
:REPEAT 2|92->125|140->173
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56906.1 GT:GENE BAD56906.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2241434..2241964) GB:FROM 2241434 GB:TO 2241964 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56906.1 LENGTH 176 SQ:AASEQ MLSKIVGPVRAHHAPLPRRDEAVERFRYRPVSPPPVGVSGRYLKQWEPDWLRKVIRKIDAAPARRPSSADSSTVRPRRLDRRLSATTIAELVQGYRGGASTNRLCEQYGLSKGGLLKILQEHGVKMRYQPMTDEETDWAVRLYGEGQSLNAVARQLGKSKGRVWKALRSSGIQSQS GT:EXON 1|1-176:0| NREPEAT 1 REPEAT 2|92->125|140->173| SEG 27->42|ryrpvspppvgvsgry| SEG 59->72|daaparrpssadss| HM:PFM:NREP 2 HM:PFM:REP 135->159|PF02796|0.00013|28.0|25/45|HTH_7| HM:PFM:REP 81->112|PF01527|0.00063|31.2|32/76|Transposase_8| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------1----2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 64-85, 174-176| PSIPRED ccHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccHHcccccHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHccccccccccHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHcccccc //